Relevant bibliographies by topics / Aluminum hydrolysis / Dissertations / Theses
To see the other types of publications on this topic, follow the link: Aluminum hydrolysis.

Dissertations / Theses on the topic 'Aluminum hydrolysis'

Author: Grafiati
Published: 4 June 2021
Last updated: 1 February 2022

Create a spot-on reference in APA, MLA, Chicago, Harvard, and other styles

Select a source type:

Consult the top 26 dissertations / theses for your research on the topic 'Aluminum hydrolysis.'

Next to every source in the list of references, there is an 'Add to bibliography' button. Press on it, and we will generate automatically the bibliographic reference to the chosen work in the citation style you need: APA, MLA, Harvard, Chicago, Vancouver, etc.

You can also download the full text of the academic publication as pdf and read online its abstract whenever available in the metadata.

Browse dissertations / theses on a wide variety of disciplines and organise your bibliography correctly.

1

Madem, Akhil. "Enhancing Reaction System for Hydrolysis on Aluminum." Thesis, KTH, Kemiteknik, 2019. http://urn.kb.se/resolve?urn=urn:nbn:se:kth:diva-266447.

Full text
Abstract:
A range extender in a battery electric vehicle supplements the existing drive system as an add-on module. Range extenders can comprise of any combination of conventional fuel, battery or fuel cell driven modules. The idea of a sub-system changes with the type of range extender. In this work, hydrogen generation is studied, a fuel is used to power the range extender via a fuel cell.The thesis presents the work in progress for development of the sub-system for a range extender based on on-board production of hydrogen for automobiles. Several aspects of chemistry play equally pivotal role in cont
APA, Harvard, Vancouver, ISO, and other styles
2

Saukkoriipi, J. (Jaakko). "Theoretical study of the hydrolysis of aluminum complexes." Doctoral thesis, University of Oulu, 2010. http://urn.fi/urn:isbn:9789514261831.

Full text
Abstract:
Abstract This thesis focuses on the molecular-level chemistry of the solvation of aluminum salts. Fundamental aspects such as, structural characteristics of the aluminum molecules, hydrolysis, acidity, solvation structure, effect of counter ions, and chemical stability are discussed herein. Static computations augmented with the conductor-like screening model (COSMO) were used to investigate hundreds of planar and cyclic configurations of dimeric, trimeric, tetrameric, and pentameric aluminum complexes. Car–Parrinello molecular dynamics (CPMD) calculations were used to expand investigations to
APA, Harvard, Vancouver, ISO, and other styles
3

White, George Norman. "Measurement of hydrolysis, polymerization and complexation in dilute aluminum solutions." Diss., Virginia Polytechnic Institute and State University, 1987. http://hdl.handle.net/10919/53664.

Full text
Abstract:
The nature of chemical reactions taking place during the titration of dilute Al solutions in the presence of either chloride or sulfate were examined by refining the apparent Al hydrolysis products assuming the presence of solution species with n (OH/Al mole ratio) equal to 1, 2, 2.5, 3 and 4. The second and third hydrolysis products for Al were refined by comparison of calculated titration patterns to those observed for 10⁻³, 10⁻⁴ and 10⁻⁵ M Al in 1 M, 0.1 M and 0.01 M KCl. A large degree of polynuclear character of Al solutions was found even at Al concentrations as low as 10⁻⁵ M. The n valu
APA, Harvard, Vancouver, ISO, and other styles
4

Chen, Minyi Carleton University Dissertation Chemistry. "The structure binding relationship of aluminum hydrolysis species with hydrophilic gels." Ottawa, 1993.

Find full text
APA, Harvard, Vancouver, ISO, and other styles
5

Abeysinghe, Samangi. "Keggin-type aluminum nanoclusters: synthesis, structural characterization and environmental implications." Thesis, University of Iowa, 2012. https://ir.uiowa.edu/etd/2430.

Full text
Abstract:
Hydrolysis products of aluminum that exist in aqueous solutions play an important role in controlling the fate and transport of contaminants and are also used for coagulants to purification of wastewater streams. Adsorption of contaminants such as heavy metals and organics are widely recognized, but the molecular level understanding of the mechanism of action has not been clearly defined. In this research we present the crystallization, structural characterization and chemical characterization of three novel Keggin-type al
APA, Harvard, Vancouver, ISO, and other styles
6

Li, Peng. "Innovative process solutions towards recycling of salt cake from secondary aluminum smelting." Doctoral thesis, KTH, Materialens processvetenskap, 2012. http://urn.kb.se/resolve?urn=urn:nbn:se:kth:diva-101074.

Full text
Abstract:
To offer better solutions for the recycling of salt cake from secondary aluminum melting, several innovative investigations were carried out based on hydrometallurgical and pyrometallurgical views. Thermal diffusivity measurements as a function of temperature on salts-Al composites having various compositions (0, 2, 4, 6, 8, 10, 12wt pct metallic Al) were carried out. Its attempt to derive theoretical relationships between aluminium contents in the salt-Al composites and the thermal conductivities so that these would serve as calibration curves for industrial samples taken out from secondary a
APA, Harvard, Vancouver, ISO, and other styles
7

Masion, Armand. "Chimie moléculaire et colloïdale des complexes organiques de l'aluminium III partiellement hydrolysés." Vandoeuvre-les-Nancy, INPL, 1993. http://www.theses.fr/1993INPL028N.

Full text
Abstract:
Les acides organiques modifient considérablement le déroulement de l'hydrolyse de l'aluminium par blocage des oligomères intermédiaires entre le monomère et le tridecamère. Les précipités présentent une structure variable suivant l'échelle d'observation
APA, Harvard, Vancouver, ISO, and other styles
8

Sarpola, A. (Arja). "The hydrolysis of aluminium, a mass spectrometric study." Doctoral thesis, University of Oulu, 2007. http://urn.fi/urn:isbn:9789514285578.

Full text
Abstract:
Abstract This thesis is focused on the hydrolysis of aluminium, the polymerisation of the hydrolysis products, and how these can be monitored by mass spectrometric methods. The main aim of this research is to figure out how the aqueous speciation of aluminium changes as a function of pH (3.2–10), concentration (1–100 mM), reaction time (1s–14d), and counter anion (Cl-, SO42-, HCOO-). The method used was electrospray mass spectrometry. The results showed more variable speciation than those suggested earlier. The main species were Al2, Al3, and Al13, which were found in all of the conditions und
APA, Harvard, Vancouver, ISO, and other styles
9

Santos, Camila Sanzovo Barbosa dos. "Aspectos de sustentabilidade em um processo de produção de hidrogênio com a reutilização do alumínio." Universidade Tecnológica Federal do Paraná, 2017. http://repositorio.utfpr.edu.br/jspui/handle/1/3217.

Full text
Abstract:
Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES)<br>Levando em consideração medidas para diminuir os efeitos das mudanças climáticas e tecnologias que auxiliam na segurança energética, esta dissertação tem como tema central o estudo da geração de gás hidrogênio como energia alternativa. O gás hidrogênio é um vetor energético com reduzidas emissões de poluentes na atmosfera se comparados com as fontes tradicionais existentes de energia. No entanto, estudos e pesquisas sobre suas potencialidades e viabilidades, tanto técnicas quanto socioeconômicas e ambientais, precisam ser d
APA, Harvard, Vancouver, ISO, and other styles
10

Benyattou, Abdelkader. "Thermohydrolyse de solutions d'aluminium III, conditions d'apparition de phases solides : caractérisations physico-chimiques des précipités." Lyon 1, 1994. http://www.theses.fr/1994LYO10071.

Full text
Abstract:
La thermohydrolyyse, obention d'une phase solide par ebullition prolongee d'une solution initialement homogene, peut etre une technique interessante. Elle assure une bonne reproductibilite et limite la dispersion des proprietes texturales des solides obtenus. Des hydroxysulfates appartenant a la famille des alunites peuvent se former par thermohydrolyse de solutions de sulfate d'aluminium. L'influence de la composition des solutions a ete etudiee. Il est clairement etabli que l'alunite se forme en presence des cations na#+ ou nh#4#+ mais non pas en presence de li#+. Le rendement de precipitati
APA, Harvard, Vancouver, ISO, and other styles
11

Soames, Mark. "Sol-gel routes to platinum, platinum-tin and platinum-potassium reforming catalysts." Thesis, Brunel University, 2000. http://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.311280.

Full text
APA, Harvard, Vancouver, ISO, and other styles
12

D’Oliveira, Elisabete Castro. "Origem da acidez da nascente do rio Campo Belo, maciço do Itatiaia - R.J." Niterói, 2017. https://app.uff.br/riuff/handle/1/5382.

Full text
Abstract:
Submitted by Biblioteca de Pós-Graduação em Geoquímica BGQ (bgq@ndc.uff.br) on 2017-12-18T14:58:25Z No. of bitstreams: 1 Dissertação realmente corrigida.pdf: 2600370 bytes, checksum: f6dfd5312d899b3cc7513282683ff5be (MD5)<br>Made available in DSpace on 2017-12-18T14:58:25Z (GMT). No. of bitstreams: 1 Dissertação realmente corrigida.pdf: 2600370 bytes, checksum: f6dfd5312d899b3cc7513282683ff5be (MD5)<br>Coordenação de Aperfeiçoamento de Pessoal de Nível Superior<br>Universidade Federal Fluminense. Instituto de Química. Programa de Pós-Graduação em Geoquímica, Niterói, RJ<br>Pode-se considerar a
APA, Harvard, Vancouver, ISO, and other styles
13

Fournier, Agathe. "Interactions of pure aluminium hydrolytic species Keggin polyoxocations and hydroxide with biologically relevant molecules." Thesis, Nottingham Trent University, 2008. http://irep.ntu.ac.uk/id/eprint/99/.

Full text
Abstract:
The general purpose of this thesis is concerned with the intricate interactions of pure aluminium species with biomolecules. Pure aluminium reference systems (aluminium monomers, Keggin aluminium polyoxocations - Al13 and Al30, and aluminium hydroxide suspensions) were used for systematic mechanistic studies of the sol-gel transformation of aqueous solutions of aluminium-ions into aluminium (oxy) hydroxides induced by the addition of a 'soft base' - Trizma-base, which does not ionize fully in an aqueous solution. The conversion proceeds via forced hydrolysis-condensation of aluminium-ions into
APA, Harvard, Vancouver, ISO, and other styles
14

Allouche, Lionel. "Etude par RMN des mécanismes de formation par hydrolyse des polycations d'aluminium." Université Louis Pasteur (Strasbourg) (1971-2008), 2001. http://www.theses.fr/2001STR13222.

Full text
APA, Harvard, Vancouver, ISO, and other styles
15

Molis, Elisabeth. "Dissolution en suspension et en position d'intercalation des formes hydrolysées de l'aluminium en interaction avec des ligands organiques." Vandoeuvre-les-Nancy, INPL, 1996. http://www.theses.fr/1996INPL123N.

Full text
Abstract:
Les études concernant l'évolution chimique et structurale d'espèces d'aluminium en présence de salicylate ont été menées en combinant plusieurs méthodes d'analyses telles que l'électrophorèse, les spectroscopies infrarouges et RMN, les méthodes thermiques et de diffusion de rayonnement. Dans les cas étudiés, les agrégats d'Al13, la gibbsite et la montmorillonite intercalée par l'Al13, ces méthodes nous ont permis de mettre en évidence des changements structuraux important, du à la dissolution de l'aluminium en fonction de la concentration en ligand organique. L’interaction entre les espèces d'
APA, Harvard, Vancouver, ISO, and other styles
16

Chamoun, Rita. "Elaboration de films catalytiques co-alumine par dépôt électrophorétique pour l'hydrolyse du NaBH4 : développement du procédé dans une perspective de valorisation d'argiles naturelles du Liban comme supports de catalyseurs." Thesis, Lyon 1, 2010. http://www.theses.fr/2010LYO10167.

Full text
Abstract:
L’hydrolyse spontanée du NaBH4 en milieu aqueux est une réaction lente nécessitant l’emploi d’un catalyseur pour l’accélérer. Nous présentons ici l’élaboration de catalyseurs Co supporté sur αAl2O3 mis forme de films, plus appropriés pour des applications nécessitant un démarrage/arrêt à la demande de la génération d’H2. Les films sont déposés sur un substrat Cu par dépôt électrophorétique (DEP). Par ailleurs, des catalyseurs Co supporté sur différentes argiles naturelles (Kaolinite, Illite-A et Illite-B) en provenance du Liban ont été élaborés. Le Co a été déposé sur αAl2O3 par six voies diff
APA, Harvard, Vancouver, ISO, and other styles
17

BERGAMASCHI, VANDERLEI S. "Preparação e caracterização de catalisadores de metais de transição suportados em zircônia. Uso na reforma a vapor do etanol para obtenção de hidrogênio." reponame:Repositório Institucional do IPEN, 2005. http://repositorio.ipen.br:8080/xmlui/handle/123456789/11359.

Full text
Abstract:
Made available in DSpace on 2014-10-09T12:51:04Z (GMT). No. of bitstreams: 0<br>Made available in DSpace on 2014-10-09T14:07:38Z (GMT). No. of bitstreams: 1 11129.pdf: 7996300 bytes, checksum: d14b1b217192ca316a3d971bede18997 (MD5)<br>Tese (Doutoramento)<br>IPEN/T<br>Instituto de Pesquisas Energeticas e Nucleares - IPEN/CNEN-SP
APA, Harvard, Vancouver, ISO, and other styles
18

Piot, Jean-Marie. "Contribution à l'étude de la production et de la résolution d'un hydrolysat d'hémoglobine bovine : applications." Compiègne, 1989. http://www.theses.fr/1989COMPDE84.

Full text
Abstract:
Ce travail, présenté sous la forme de publications, concerne, l'étude de la production et de la résolution d'un hydrolysat enzymatique d'hémoglobine bovine. La première partie décrit la préparation en batch d'un hydrolysat pepsique décoloré en utilisant soit de l'alumine, soit de la magnésie. Ensuite une production en continu, au stade pilote, d'un hydrolysat pepsique incolore et reproductible a été mise au point. L'hydrolyse enzymatique de l'hémoglobine est réalisée dans un réacteur à ultrafiltration équipé de membranes minérales. La reproductibilité de l'hydrolysat ainsi produit a été démont
APA, Harvard, Vancouver, ISO, and other styles
19

Rupprecht, Christian. "Ganzheitliche Verfahrens- und Schichtoptimierung für das Hochgeschwindigkeitsdrahtflammspritzen." Doctoral thesis, Universitätsbibliothek Chemnitz, 2009. http://nbn-resolving.de/urn:nbn:de:bsz:ch1-200900553.

Full text
Abstract:
Das Ziel der Dissertation ist die Charakterisierung und Optimierung der Prozessbedingungen beim Hochgeschwindigkeitsdrahtflammspritzen. Dazu werden diagnostische Methoden wie das LDA-Verfahren, die Bewertung von Schichten und numerische Betrachtungen herangezogen. Verschiedene Spritzzusatzwerkstoffe wie Massiv- und Fülldrähte sowie hoch- und niedrigschmelzende Materialien werden verarbeitet. Zur Bewertung der Gebrauchseigenschaften erfolgen Korrosions- und Verschleißtests. Aus den Untersuchungsergebnissen resultieren Hinweise und Konzepte zur Verbesserung der Brennertechnik. Die Entwicklung ei
APA, Harvard, Vancouver, ISO, and other styles
20

Ticu, Elena-Loredana. "Proteoliza enzimatică dirijată a proteinelor alimentare în scopul obţinerii de peptide cu proprietăţi funcţionale sau biologice." Lille 1, 2006. https://ori-nuxeo.univ-lille1.fr/nuxeo/site/esupversions/b766d7b6-81c6-4172-8f51-d1111ae35818.

Full text
Abstract:
La pepsine de porc est immobilisée sur un nouveau support minéral: l'alumine acide fonctionnalisée par la phosphoéthanolamine afin de diminuer l'adsorption des peptides produits au cours de l'hydrolyse de l'hémoglobine bovine. Ce support modifié avec la pepsine insolubilisée permet d'obtenir des cinétiques d'hydrolyse de l'hémoglobine proche de l'hydrolyse réalisée en catalyse homogène, où la pepsine est libre en solution, et de réduire l'adsorption des peptides. Le support modifié avec la pepsine immobilisée a était utilisé pour la mise au point d'un réacteur ouvert biphasique de type solide/
APA, Harvard, Vancouver, ISO, and other styles
21

Rupprecht, Christian. "Ganzheitliche Verfahrens- und Schichtoptimierung für das Hochgeschwindigkeitsdrahtflammspritzen." Eigenverlag, 2008. https://monarch.qucosa.de/id/qucosa%3A19103.

Full text
Abstract:
Das Ziel der Dissertation ist die Charakterisierung und Optimierung der Prozessbedingungen beim Hochgeschwindigkeitsdrahtflammspritzen. Dazu werden diagnostische Methoden wie das LDA-Verfahren, die Bewertung von Schichten und numerische Betrachtungen herangezogen. Verschiedene Spritzzusatzwerkstoffe wie Massiv- und Fülldrähte sowie hoch- und niedrigschmelzende Materialien werden verarbeitet. Zur Bewertung der Gebrauchseigenschaften erfolgen Korrosions- und Verschleißtests. Aus den Untersuchungsergebnissen resultieren Hinweise und Konzepte zur Verbesserung der Brennertechnik. Die Entwicklung ei
APA, Harvard, Vancouver, ISO, and other styles
22

Tsai, Yi-Chen, and 蔡億澄. "Rapid Hydrolysis of Aluminum Nitride by Microwave." Thesis, 2015. http://ndltd.ncl.edu.tw/handle/61054897742381890130.

Full text
Abstract:
碩士<br>國立高雄應用科技大學<br>化學工程與材料工程系碩士在職專班<br>103<br>Aluminum nitride (AlN) can be easily hydrolyzed. However, the product layer increases the diffusion resistance, resulting to the decrease of hydrolysis rate. In this study, the microwave-assisted hydrolysis method was proposed for the rapid hydrolysis of AlN due to the energy transfer of microwave via the molecule polarization, leading to the reduction of the energy loss in the heat conduction process. Moreover, the effects of experimental parameters, including reaction temperature (25, 45, 70, 90 ℃), reaction time (0-129 min), and applied power (
APA, Harvard, Vancouver, ISO, and other styles
23

Yu-ChiaChang and 張裕佳. "Stabilization of secondary aluminum dross via hydrolysis treatment." Thesis, 2015. http://ndltd.ncl.edu.tw/handle/47490507663776696872.

Full text
Abstract:
碩士<br>國立成功大學<br>資源工程學系<br>103<br>Domestic Aluminum Production Industry produces about over than ten thousand tons of secondary aluminum dross (the raw material), including Al2O3 and AIN. The secondary aluminum dross can easily react to the air and gives out unbearable stanch—improper management of the raw material will damage the overall environment. Considering different reaction time, processing temperature, reacting solvent, and solid to liquid ratio, the experiment of this study applies hydrolysis treatment to find out the best parameters. The result of this study shows, when NaOH is used
APA, Harvard, Vancouver, ISO, and other styles
24

Huang, Yen-Yu, and 黃硯毓. "Rapid Hydrolysis of Aluminum Nitride by Ultrasonic Wave-Enhanced Process." Thesis, 2013. http://ndltd.ncl.edu.tw/handle/75845914021229082340.

Full text
Abstract:
碩士<br>國立高雄應用科技大學<br>化學工程與材料工程系博碩士班<br>101<br>Due to the high reactivity of aluminum nitride (AlN) powder with water, the product layer will be generated on the surface of powders, resulting in the elevation of diffusion resistance and the difficulty of complete hydrolysis of AlN particles. Therefore, in this study, the rapid hydrolysis of aluminum nitride via the ultrasonic wave-enhanced process by means of the cavitation erosion of ultrasonic wave to decrease the diffusion resistance of product layer has been proposed. The performance of AlN hydrolysis is compared between the traditional heat
APA, Harvard, Vancouver, ISO, and other styles
25

Jyun-SianLi and 李俊賢. "A study on the improvement of anti-hydrolysis property of aluminum nitride." Thesis, 2011. http://ndltd.ncl.edu.tw/handle/42310750150465452359.

Full text
APA, Harvard, Vancouver, ISO, and other styles
26

Wang, Shan-Li, and 王尚禮. "Studies on the hydrolysis of aqueous solutions of aluminum perchlorate and formation of gibbsite." Thesis, 1993. http://ndltd.ncl.edu.tw/handle/83728481192954616561.

Full text
Abstract:
碩士<br>國立臺灣大學<br>農業化學系<br>81<br>The ferron-colorimetric kinetics method, sulfate precipitates, transmission and scanning electronic mocroscopies, x-ray diffraction, Al-27 solution and solid state nuclear magnetic resonance analysis were employed to study the speciations in aluminum hydrolytic solutions. The Al polycations or polymers present in these solutions were characterized. These polymeric species precipitated by sulfate anion were present in the shapes of sphere, lath and irregular m
APA, Harvard, Vancouver, ISO, and other styles
We offer discounts on all premium plans for authors whose works are included in thematic literature selections. Contact us to get a unique promo code!

To the bibliography