Relevant bibliographies by topics / Characterization of producer

Contents

  1. Journal articles
  2. Dissertations / Theses
  3. Books
  4. Book chapters
  5. Conference papers
  6. Reports

Academic literature on the topic 'Characterization of producer'

Author: Grafiati
Published: 4 June 2021
Last updated: 13 February 2022

Create a spot-on reference in APA, MLA, Chicago, Harvard, and other styles

Select a source type:

Consult the lists of relevant articles, books, theses, conference reports, and other scholarly sources on the topic 'Characterization of producer.'

Next to every source in the list of references, there is an 'Add to bibliography' button. Press on it, and we will generate automatically the bibliographic reference to the chosen work in the citation style you need: APA, MLA, Harvard, Chicago, Vancouver, etc.

You can also download the full text of the academic publication as pdf and read online its abstract whenever available in the metadata.

Journal articles on the topic "Characterization of producer"

1

Russell, R. A., and J. M. Bewley. "Characterization of Kentucky dairy producer decision-making behavior." Journal of Dairy Science 96, no. 7 (2013): 4751–58. http://dx.doi.org/10.3168/jds.2012-6538.

Full text
APA, Harvard, Vancouver, ISO, and other styles
2

Gasparotto, Elainy Patrícia Lino, Sorrailla Carolina Carrard Abrão, Suely Yaeko Inagaki, Dauri José Tessmann, Carlos Kemmelmeier, and Ione Parra Barbosa Tessmann. "Production and characterization of galactose oxidase produced by four isolates of Fusarium graminearum." Brazilian Archives of Biology and Technology 49, no. 4 (2006): 557–64. http://dx.doi.org/10.1590/s1516-89132006000500004.

Full text
Abstract:
A screening aimed to find new galactose oxidase producer isolates and to evaluate the production among Fusarium graminearum strains was conducted. Thirty-five isolates out of 39 analysed produced the enzyme at several levels. The data indicated a wide distribution of galactose oxidase within F. graminearum and also revealed new producer isolates. The enzyme produced by different isolates showed similar thermal activity and stability and were active on same substrates. However, the optimum pH ranged from 7.0 to 7.5. Thus, all evaluated isolates were suitable for the production of galactose oxidase.
APA, Harvard, Vancouver, ISO, and other styles
3

López, Fabián, Osvaldo D. Delgado, M. Alejandra Martínez, John F. T. Spencer, and Lucía I. C. Figueroa. "Characterization of a new xylitol-producer Candida tropicalis strain." Antonie van Leeuwenhoek 85, no. 4 (2004): 281–86. http://dx.doi.org/10.1023/b:anto.0000020368.37876.1c.

Full text
APA, Harvard, Vancouver, ISO, and other styles
4

Basu, S., S. K. Bose Jr, and S. K. Bose. "Characterization of versilin-sensitive sites in self-sensitive producer and sensitive non-producer or unrelated organism." Journal of Applied Bacteriology 67, no. 2 (1989): 191–200. http://dx.doi.org/10.1111/j.1365-2672.1989.tb03395.x.

Full text
APA, Harvard, Vancouver, ISO, and other styles
5

Gautam, Neha, and Nivedita Sharma. "Characterization of bacteriocin producer “Lactobacillus brevis un” as potentialprobiotic strain." Journal of Microbiology, Biotechnology and Food Sciences 05, no. 03 (2016): 216–20. http://dx.doi.org/10.15414/jmbfs.2015/16.5.3.216-220.

Full text
APA, Harvard, Vancouver, ISO, and other styles
6

Nayak, Swarup Kumar, Purna Chandra Mishra, and Gyana Ranjan Behera. "Characterization of coconut shell imitatived producer gas in adiesel engine." Energy Sources, Part A: Recovery, Utilization, and Environmental Effects 39, no. 16 (2017): 1718–24. http://dx.doi.org/10.1080/15567036.2016.1141266.

Full text
APA, Harvard, Vancouver, ISO, and other styles
7

Brandtner, Eva Maria, Petra Kodajova, Elzbieta Knapp, et al. "Quantification and Characterization of Autotransduction in Retroviral Vector Producer Cells." Human Gene Therapy 19, no. 1 (2008): 97–102. http://dx.doi.org/10.1089/hum.2007.071.

Full text
APA, Harvard, Vancouver, ISO, and other styles
8

Petković, Hrvoje, John Cullum, Daslav Hranueli, et al. "Genetics of Streptomyces rimosus, the Oxytetracycline Producer." Microbiology and Molecular Biology Reviews 70, no. 3 (2006): 704–28. http://dx.doi.org/10.1128/mmbr.00004-06.

Full text
Abstract:
SUMMARY From a genetic standpoint, Streptomyces rimosus is arguably the best-characterized industrial streptomycete as the producer of oxytetracycline and other tetracycline antibiotics. Although resistance to these antibiotics has reduced their clinical use in recent years, tetracyclines have an increasing role in the treatment of emerging infections and noninfective diseases. Procedures for in vivo and in vitro genetic manipulations in S. rimosus have been developed since the 1950s and applied to study the genetic instability of S. rimosus strains and for the molecular cloning and characterization of genes involved in oxytetracycline biosynthesis. Recent advances in the methodology of genome sequencing bring the realistic prospect of obtaining the genome sequence of S. rimosus in the near term.
APA, Harvard, Vancouver, ISO, and other styles
9

Javadi, Ali, Mohamad Reza Pourmand, Javad Hamedi, et al. "Production and Characterization of Biosurfactant by Nocardia Species Isolated Form Soil Samples in Tehran." Tenside Surfactants Detergents 58, no. 1 (2021): 74–80. http://dx.doi.org/10.1515/tsd-2020-2263.

Full text
Abstract:
Abstract In this work, we report the Nocardia species were initially screened and then tested for their ability to produce biosurfactant. The biosurfactant production from the Nocardia species was determined by qualitative standard methods. The selected bacterial strain had better oil spreading and emulsifying activity and surface tension reduction. The biosurfactant producer strain was identified by 16S rRNA gene sequencing method. Using Fourier transform infrared spectroscopy and comparative analysis, the biosurfactant structure could be detected. Oil spreading tests and blue agar plate tests confirmed the presence of biosurfactant and extracellular anionic glycolipids. The E24% assay using olive oil showed strong emulsifying characteristic of extracted biosurfactant with a 100%. The stability of the biosurfactant produced in different conditions was significant. Nocardia coubleae was identified by biochemical methods and molecular methods.
APA, Harvard, Vancouver, ISO, and other styles
10

Serhan, Fatima, Nathalie Jourdan, Sylvie Saleun, Philippe Moullier, and Ghislaine Duisit. "Characterization of Producer Cell-Dependent Restriction of Murine Leukemia Virus Replication." Journal of Virology 76, no. 13 (2002): 6609–17. http://dx.doi.org/10.1128/jvi.76.13.6609-6617.2002.

Full text
Abstract:
ABSTRACT We previously reported that the human bronchocarcinoma cell line A549 produces poorly infectious gibbon ape leukemia virus-pseudotyped Moloney murine leukemia virus (MLV). In contrast, similar amounts of virions recovered from human fibrosarcoma HT1080 cells result in 10-fold-higher transduction rates (G. Duisit, A. Salvetti, P. Moullier, and F. Cosset, Hum. Gene Ther. 10:189-200, 1999). We have now extended this initial observation to other type-C envelope (Env) pseudotypes and analyzed the mechanism involved. Structural and morphological analysis showed that viral particles recovered from A549 (A549-MLV) and HT1080 (HT1080-MLV) cells were normal and indistinguishable from each other. They expressed equivalent levels of mature Env proteins and bound similarly to the target cells. Furthermore, incoming particles reached the cytosol and directed the synthesis of linear viral DNA equally efficiently. However, almost no detectable circular DNAs could be detected in A549-MLV-infected cells, indicating that the block of infection resulted from defective nuclear translocation of the preintegration complex. Interestingly, pseudotyping of A549-MLV with vesicular stomatitis virus glycoprotein G restored the amount of circular DNA forms as well as the transduction rates to HT1080-MLV levels, suggesting that the postentry blockage could be overcome by endocytic delivery of the core particles downstream of the restriction point. Thus, in contrast to the previously described target cell-dependent Fv-1 (or Fv1-like) restriction in mammalian cells (P. Pryciak and H. E. Varmus, J. Virol. 66:5959-5966, 1992; G. Towers, M. Bock, S. Martin, Y. Takeuchi, J. P. Stoye, and O. Danos, Proc. Natl. Acad. Sci. USA 97:12295-12299, 2000), we report here a new restriction of MLV replication that relies only on the producer cell type.
APA, Harvard, Vancouver, ISO, and other styles
More sources

Dissertations / Theses on the topic "Characterization of producer"

1

Garcia, Alexander Patricio. "Perfil do Orizicultor de abrangência da Região da Associação dos Municípios do Extremo Sul Catarinense." Universidade Federal de Pelotas, 2012. http://repositorio.ufpel.edu.br/handle/ri/1394.

Full text
Abstract:
Made available in DSpace on 2014-08-20T13:44:31Z (GMT). No. of bitstreams: 1 dissertacao_alexander_patricio_garcia.pdf: 1546243 bytes, checksum: b63e3fd718fbb9270d0c0fac088208fd (MD5) Previous issue date: 2012-12-07<br>The present work aimed to evaluate the producer of rice profile of the Association of Municipalities in the Catarinense Extreme Southern (AMESC) in relation to the utilization rate of certified seeds as well as the cultural practices in the pre-germinated rice cultivation system. For this work development, a questionnaire survey was applied to the farmers of the AMESC region, who cultivate rice into the pre germinated system. All municipalities that cultivate rice in the AMESC comprisement, had interviewed farmers. Forty-eight properties altogether, were searched; just four properties in each country. There was no survey in Balneário Arroio do Silva, Balneário Gaivota and Passo de Torres, where no rice is produced. The work showed that the utilization rate of certified seeds in the rural properties reached (79%), being above the average (53%) of the utilization rate of Brazil certified seeds for irrigated rice. It s possible to conclude the utilization rate of certified seeds in the AMESC region is higher than the Brazilian average. Such component of production contributes for a better productivity and rentability of the catarinense southern rice farmings.<br>O presente trabalho teve por objetivo avaliar o perfil do orizicultor da região de abrangência da Associação dos Municípios do Extremo Sul Catarinense (AMESC) quanto à taxa de utilização de sementes certificadas e às práticas culturais no sistema de cultivo de arroz pré germinado. Para o desenvolvimento deste trabalho, foi realizada uma pesquisa com a aplicação de um questionário aos produtores rurais da região da AMESC que cultivam arroz no sistema pré germinado. Todos os municípios que cultivam arroz da região de abrangência da AMESC tiveram produtores entrevistados, totalizando 48 propriedades pesquisadas, sendo aplicado o questionário em quatro propriedades por município. Não houve pesquisa nos municípios de Balneário Arroio do Silva, Balneário Gaivota e Passo de Torres pelo fato de não produzirem arroz. O trabalho mostrou que taxa de utilização de sementes certificadas nas propriedades rurais alcançou 79%, estando acima da média (53%) da taxa de utilização de sementes certificadas do Brasil para o arroz irrigado. É possível inferir que a região da AMESC possui uma taxa de utilização de sementes certificadas acima da média brasileira e que este componente da produção contribui para melhorar a produtividade e a rentabilidade das lavouras orizicolas sul catarinense.
APA, Harvard, Vancouver, ISO, and other styles
2

Chen, Minliang [Verfasser]. "Novel approaches for in vivo evolution, screening and characterization of enzymes for metabolic engineering of Escherichia coli as hyper L-tryptophan producer / Chen Minliang." Hamburg : Universitätsbibliothek der Technischen Universität Hamburg-Harburg, 2020. http://d-nb.info/1224270819/34.

Full text
APA, Harvard, Vancouver, ISO, and other styles
3

Chen, Minliang [Verfasser]. "Novel approaches for in vivo evolution, screening and characterization of enzymes for metabolic engineering of Escherichia coli as hyper L-tryptophan producer / Minliang Chen." München : Verlag Dr. Hut, 2021. http://d-nb.info/1232847674/34.

Full text
APA, Harvard, Vancouver, ISO, and other styles
4

Eismin, Ryan J., and Ryan J. Eismin. "Surface, Aggregation, and Phase Characterization of Microbially-Produced & Chemically-Synthesized Monorhamnolipids." Diss., The University of Arizona, 2017. http://hdl.handle.net/10150/623026.

Full text
Abstract:
The purpose of this research has been to explore the native monorhamnolipid (mRL) mixture produced by Pseudomonas aeruginosa ATCC 9027, as well as newly- synthesized monorhamnolipid diastereomers (R,R)-Rha-C10-C10, (R,S)-Rha-C10-C10, (S,S)-Rha-C10-C10 and (S,R)-Rha-C10-C10, to understand their aggregation and phase behavior in aqueous solution. This work is in response to the consideration that biosurfactants offer a "greener" alternative to conventional surfactants. Relationships between chemical structure of the diastereomers and surface activity were studied using surface tension measurements. It was found that the critical aggregation concentration (CAC) values are lower for deprotonated (R,S)-Rha-C10-C10 and higher for protonated (R,S)-Rha-C10-C10 compared to the other diastereomers or the native mRL mixture. Furthermore, the 1:1:1:1 diastereomeric mixture has the overall lowest cross-sectional area for deprotonated rhamnolipids. Dynamic light scattering (DLS) was used to study the hydrodynamic radii (Rh) of the mRL aggregates and the four diastereomers in aqueous solution. In all five surfactants studied, each observed at pH 8.0 and 4.0, three aggregate populations were observed. For all deprotonated rhamnolipids the micelle, at a hydrodynamic radius of ~2 nm, was found to be in the highest abundance where the two lower abundant other population take on a lamellar aggregate structure. Data to support this were collected using fluorescence probing techniques. For the surfactants in the protonated state, pH 4.0, it was found that all form primarily lamellar structures, also confirmed using fluorescence probing. The average aggregation numbers (Nagg) of the micelles for the deprotonated native mRL mixture and the four diastereomers were studied using steady-state and time-resolved fluorescence quenching measurements. Somewhat unexpectedly, the Nagg values were observed to be a strong function of the rhamnolipid concentration for all systems. At low concentrations, pre-micellar aggregates with aggregation numbers too small for micelles were observed. A critical concentration is identified at which a critical aggregation number is defined; this is proposed to be the smallest fully-formed micelle in solution with values of ~25-30 molecules/micelle for the native mRL mixture and all four diastereomers. Thus, the aggregation properties of the native mRL mixture and the four diastereomers are generally similar at this critical concentration. However, the increase in aggregation number above this critical point varies for all the surfactants, where the (R,R)-Rha-C10-C10 diastereomer has the greatest increase in monomers with concentration and the (S,S) and (R,S) diastereomers have the lowest. The increased observed aggregation number is consistent with the computational work showing increased growth with concentration for the deprotonated rhamnolipid micelles. Furthermore, these computations have confirmed the ability of protonated rhamnolipids to form lamellar structures in solution. Fluorescence probing work was also used to study rhamnolipid phase behavior as a function of varying solution conditions, such as ionic strength, solution pH, surfactant concentration, and temperature. Steady-state fluorescence methods are utilized to probe the surfactant microenvironment using the polarity-sensitive dyes prodan and laurdan. By dissolving the dye within the rhamnolipid aggregates and observing their solvatochromic behavior, all surfactants studied are known to form more micellar aggregates at high pH and low surfactant concentration, whereas elongation of the micelle is observed at low pH and moderate to high surfactant concentration.
APA, Harvard, Vancouver, ISO, and other styles
5

Jackson, Linda C. "Neutral solvent pulping product characterization." Thesis, Georgia Institute of Technology, 1985. http://hdl.handle.net/1853/11234.

Full text
APA, Harvard, Vancouver, ISO, and other styles
6

Zhou, Dan. "Characterization of carbon nanoclusters produced by arc-discharge." Diss., The University of Arizona, 1995. http://hdl.handle.net/10150/187312.

Full text
Abstract:
The research covered in this dissertation presents a systematic study for growth phenomena of carbon nanoclusters prepared by a arc discharge technique. Through a series of experiments, it has been found that morphology and yield of nanotubes strongly depend on the processing parameters. A low current density of 190 A/cm², a discharge voltage of 27 V, a high helium pressure of 550 torr, and a minimum electrode gap offered the best condition for synthesis of carbon nanotubes. According to a detailed study of carbon nanoclusters by TEM, the rich variety of growth phenomena, in particular non-concentric and complex branching phenomena are reported. These phenomena have demonstrated that the growth process of nanotubes is apparently more complex than what the existing growth models suggest. Further refinement and expansions of these models are important for technological exploitation of nanotubes and may be identified and guided by the present results. The reaction of foreign materials with carbon vapor in the arc results in their encapsulation into carbon cages, as well as the formation of other novel forms of carbon nanoclusters. Among more than eighteen elements introduced into the discharge in this study, B, Y, Zr, Nb, and Mo are most easily encapsulated in the form of their carbides into carbon nanoclusters. Through the detailed study, it has been found that the encapsulation occurs most easily in the materials with the incompletely-filled 4d electron shell for the refractory materials. Furthermore, it is reported that Fe, Co, Ni, or YC₂ working as catalysts stimulate the formation of single-walled nanotubes (SWTs), and mixtures of these catalysts greatly enhance the yield of SWTs. Based on morphologies of the star patterns of SWTs produced by an anode containing YC₂, their step-by-step growth mechanism is proposed. In addition to the SWTs, it has been found that Fe or Ni also stimulates the formation of strings of carbon nanobeads. A growth model for this phenomenon is presented. Finally, the conversion of carbon nanotubes into SiC whiskers is reported. In contrast to the conventional process, starting with nanotubes offers a high purity SiC whisker without any metal impurity.
APA, Harvard, Vancouver, ISO, and other styles
7

Van, Reenen Carol A. (Carol Ann). "Characterization of bacteriocin 423 produced by Lactobacillus pentosus." Thesis, Stellenbosch : Stellenbosch University, 2000. http://hdl.handle.net/10019.1/51652.

Full text
Abstract:
Thesis (PhD)--University of Stellenbosch, 2000.<br>ENGLISH ABSTRACT: Worldwide, bacteriocins, particularly those produced by food-related lactic acid bacteria, are receiving attention due to the possible use of these peptides as natural preservatives in food, replacing potentially harmful chemical preservatives. Bacteriocins are ribosomally synthesized proteins or peptides that inhibit closely related microorganisms. Most bacteriocins produced by lactic acid bacteria are small, heat resistant peptides that inhibit other Gram-positive bacteria, including food-borne pathogens such as Listeria monocytogenes, Bacillus cereus, Clostridium perfringens and Staphylococcus aureus, but do not inhibit Gram-negative bacteria, molds or fungi. Bacteriocins are produced as inactive prepeptides that become active after the N-terminal leader peptide is cleaved off. Small heat resistant bacteriocins are either lantibiotics (Class I), containing unusual posttranslationally modified amino acids, or peptides that are non-Ianthionines (Class II). The Class II bacteriocins are further divided into four different groups: Class lIa, the anti-listerial bacteriocins containing the YGNGV consensus sequence in the N-terminal of the protein, Class lib, bacteriocins consisting of two peptides, Class IIc, bacteriocins that are secreted via the sec pathway, and Class lid, bacteriocins that do not belong in the previous three subgroups. A bacteriocin producing lactic acid bacterium was isolated in our laboratory from traditionally home fermented South African sorghum beer. The producing bacterium was found to be a facultative heterofermentative Lactobacillus sp. and was identified as Lactobacillus plantarum or Lactobacillus pentosus by using the API 50 CHL carbohydrate fermentation system and numerical analysis of total soluble cell protein patterns. RAPD-PCR analysis identified the strain as L. plantarum, but 16S rRNA sequencing confirmed its identification as L. pentosus. The bacteriocin, first designated plantaricin 423 and later bacteriocin 423, was identified as a Class lIa small heat resistant anti-listerial bacteriocin containing the YGNGV consensus motif. Bacteriocin 423 inhibited a variety of Gram-positive bacteria, including Lactobacillus spp., Leuconostoc spp., Oenococcus oeni, Pediococcus spp., Enterococcus spp., Propionibacterium spp., Staphylococcus spp., Bacillus spp., Clostridium spp. and Listeria spp. The bacteriocin was inactivated by proteolytic enzymes and active over a wide pH range (pH 1-10). Bacteriocin 423 lost 50 % of its activity after autoclaving for 15 min at 121°C, but was not affected by lesser heat treatments. Bacteriocin production was increased by optimizing the growth medium, which consisted of glucose, tryptone, yeast extract, potassium phosphate, sodium acetate, ammonium citrate, manganese sulphate, Tween 80 and casamino acids. The bacteriocin was found to be plasmid-encoded. Genetic analysis of the bacteriocin operon indicated a high percentage of homology to the operon of another Class lIa bacteriocin, pediocin PA-1, although the structural genes of the two bacteriocins were markedly different. The structural gene of bacteriocin 423 was amplified by PCR and cloned into a yeastJE. coli vector between the ADH1 promoter and terminator sequences and fused in-frame to the MFa1 secretion signal sequence. Saccharomyces cerevisiae transformed with this plasmid expressed the bacteriocin. The sequence of prebacteriocin 423 (MMKKIEKL TEKEMANIIGGKYYGNGVTCGKHSCSVN WGOAFSCSVSHLANFGHGKC) is similar, but not identical to any other reported Class lIa anti-listeria I peptide.<br>AFRIKAANSE OPSOMMING: Bakteriosiene, veral dié wat deur melksuurbakterieë geproduseer word, wek belangstelling as gevolg van die moontlike gebruik van hierdie natuurlike antimikrobiese proteiëne as preserveermiddels in voedselprodukte, in plaas van potensieël gevaarlike chemiese preserveermiddels. Bakteriosiene is ribosomaal-vervaardigde proteiëne wat naverwante bakterieë inhibeer. Die meeste bakteriosiene wat deur melksuurbakterieë geproduseer word, is klein en hittebestand. Hierdie bakteriosiene inhibeer ander Gram-positiewe bakterieë, insluitend patogene soos Listeria monocytogenes, Bacillus cereus, Clostridium perfringens en Staphylococcus aureus, maar inhibeer nie Gram-negatiewe bakterieë, giste of swamme nie. Bakteriosiene word as onaktiewe prepeptiede geproduseer, wat ge-aktiveer word wanneer die N-terminale leierpeptied afgesplits word. Klein hittebestande bakteriosiene is óf lantibiotika (Klas I), met ongewone aminosure, óf normale peptiede (Klas II). Laasgenoemde klas kan verder in vier groepe verdeel word. Klas lIa is anti-listeriese bakteriosiene met fn YGNGVaminosuurvolgorde in die N-terminale kant van die peptied. Klas lib sluit in bakteriosiene wat uit twee peptiede bestaan. Klas lie is sec-afhanklike bakteriosiene, en Klas lid sluit in al die bakteriosiene wat nie in die eerste drie groepe geklassifiseer kan word nie. 'n Bakteriosien-produserende melksuurbakterie is uit tradisionele tuisgefermenteerde Suid- Afrikaanse sorghumbier geïsoleer. Die bakterie is as 'n fakultatief heterofermentatiewe Lactobacillus sp. geïdentifiseer. Die bakterie is verder as 'n Lactobacillus plantarum of Lactobacillus pentosus geïdentifiseer deur middel van die API 50 CHL-koolhidraat fermentasiesisteem en numeriese analiese van totale oplosbare selproteiënprofiele. Met RAPD-PCR analiese is die organisme as L. plantarum geïdentifiseer, maar 168 rRNA nukleotiedopeenvolging het die identiteit van die organisme as L. pentosus bevestig. Bakteriosien 423, aanvanklik geklassifiseer as plantaricin 423, is fn klein Klas lIa, hittebestande en anti-listeriese bakteriosien met die YGNGV motief, wat verskeie Grampositiewe bakterieë inhibeer. Bakteriosien 423 het verskeie Gram-positiewe organismes geïnhibeer, onder andere Lactobacillus spp., Leuconostoc spp., Oenococcus oeni, Pediococcus spp., Enterococcus spp., Propionibacterium spp., Staphylococcus spp., Bacillus spp., Clostridium spp., en Listeria spp. Proteolitiese ensieme inaktiveer die bakteriosien. Die peptied was oor 'n pH reeks van 1-10 aktief. Outoklavering vir 15 min by 121°C het die aktiwiteit van die peptied halveer, maar die bakteriosien is nie geïnaktiveer met ander hittebehandelings nie. Produksie van die bakteriosien is verhoog deur die groeimedium te optimiseer. Die groeimedium het bestaan uit glukose, triptoon, gisekstrak, kaliumfosfaat, natriumasetaat, ammoniumsitraat, mangaansulfaat, Tween 80 en casaminosure. Die bakteriosien se genetiese determinante is op In plasmied gesetel. Genetiese analiese van die bakteriosien operon het 'n hoë homologie met In ander Klas lIa bakteriosien, pediocin PA-1, getoon, maar die strukturele gene van die twee bakteriosiene verskil merkbaar. Die strukturele geen van bakteriosien 423 is met PKR ge-amplifiseer en in 'n gistE. coli-vektor tussen die ADH1 promotor- en termineerderopeenvolgings, in leesraam met die MFa1 sekresiesein, gekloneer. Saccharomyces cerevisiae wat met hierdie plasmied getransformeer is, het bakteriosien 423 uitgedruk. Die aminosuurvolgorde van prebakteriosien 423 (MMKKIEKL TEKEMANIIGGKYYGNGVTCGKHSCSVNWGOAFSCSVSHLANFGHGKC) is verwant aan, maar nie identies aan, ander Klas lIa anti-listeriese peptiede.
APA, Harvard, Vancouver, ISO, and other styles
8

Van, der Merwe Iansha (Iansha Rosalia) 1975. "Characterization of thoeniicin 447 produced by Propionibacterium thoenii." Thesis, Stellenbosch : Stellenbosch University, 2002. http://hdl.handle.net/10019.1/52729.

Full text
Abstract:
Thesis (MSc)--University of Stellenbosch, 2002.<br>ENGLISH ABSTRACT: Antimicrobial peptides continue to be one of the most important classes of food additives. The food industry is especially interested in the application of naturally occuring and biologically derived preservatives. Among the metabolites of industrial importance produced by propionibacteria are peptides called bacteriocins. Bacteriocins are ribosomally synthesized peptides with antagonistic activity against closely related microorganisms. Many microorganisms associated with food produce bacteriocins, which have stimulated interest in the use of these peptides as natural food preservatives. Numerous bacteriocins are produced by lactic acid bacteria, but only a few have been reported for propionibacteria. Since propionic acid bacteria have GRAS (generally regarded as safe) status, their metabolic compounds should be safe for human consumption. Propionibacterium thoenii 447, isolated from Emmentaler cheese, produces a bacteriocin-like peptide, named thoeniicin 447, with a narrow spectrum of activity. The peptide displays a bactericidal mode of action against Lactobacillus delbrueckii subsp. bulgaricus and a bacteriostatic action against Propionibacterium acnes. Optimal bacteriocin production was detected during the early stationary growth phase. The peptide is resistant to heat treatments of 60°C and 80°C for 15 and 30 min and to 100°C for 15 min, but loses 80% of its activity after autoclaving (10 min at 121°C). Thoeniicin 447 remains active after incubation in buffers with pH values ranging from 1-10. The peptide is inactivated by pepsin, pronase, a-chymotrypsin, trypsin and Proteinase K. Thoeniicin 447 was partially purified by ammonium sulfate precipitation, followed by SP-Sepharose cation exchange chromatography. The estimated size of thoeniicin 447, according to tricine-SDSPAGE, is approximately 6 kDa. Based on DNA sequencing, the mature peptide is 7130 Da in size and homologous to propionicin Tl produced by P. thoenii strain 419. Thoeniicin 447 is a relatively small, cationic and heat-stable peptide and can therefor be classified as a member of class II bacteriocins. These features are very similar to those of bacteriocins produced by lactic acid bacteria. However, no unique classification system has been proposed for bacteriocins of propionibacteria. As a member of the genus Propionibacterium, P. thoenii 447 is generally regarded as safe. This, together with the narrow spectrum of activity, particularly the action against P. acnes, heat tolerance of thoeniicin 447 and its activity over a wide pH range renders the peptide suitable for possible pharmaceutical applications.<br>AFRIKAANSE OPSOMMING: Antimikrobiese middels sal deurgaans beskou word as een van die belangrikste klasse van voedsel bymiddels. Die voedselindustrie is veral geïnteresseerd in die toepassing van preserveermiddels van 'n meer natuurlike en biologiese oorsprong. Onder die metaboliese produkte van industriële belang wat deur propionibakterieë geproduseer word is antimikrobiese peptiede (bakteriosiene). Bakteriosiene is ribosomaal-gesintetiseerde peptiede met 'n antagonistiese aktiwiteit teenoor naverwante bakterieë. Verskeie bakteriosiene word deur melksuurbakterieë geproduseer, terwyl slegs enkele vir propionibakterieë beskryf is. Baie van hierdie propionibakterieë word in die algemeen as veilig beskou en het GRAS status. Die metaboliete wat hulle produseer behoort dus veilig vir menslike gebruik te wees. Propionibacterium thoenii 447 is uit Emmentaler kaas geisoleer en produseer 'n bakteriosien-agtige peptied, naamlik thoeniicin 447 met 'n beperkte spektrum van aktiwiteit. Die peptied het 'n bakteriosidiese werking teenoor Lactobacillus delbrueckii subsp. bulgaricus en 'n bakteriostatiese werking teenoor Propionibacterium acnes. Optimum bakteriosien produksie is verkry tydens die vroeë stationêre groeifase. Die peptied is bestand teen hittebehandelings van 60°C en 80°C vir 15 en 30 min, asook 100°C vir 15 min, maar verloor 80% van sy aktiwiteit na outoklavering (lOmin by 121°C). Die peptied blyaktief na inkubasie in buffers van pH 1-10. Die peptied word deur pepsien, pronase, uchymotripsien, tripsien en Proteinase K geïnaktiveer. Thoeniicin 447 is met behulp van ammoniumsulfaat-presipitasie, gevolg deur SPSepharose katioon-uitruilchromatografie gedeeltelik gesuiwer. Skeiding op "n trisien-SDS poliakrielarnied-jel het 'n aktiewe band van ongeveer 6 kDa getoon. Volgens die DNA volgorde bepaling is thoeniicin 447, 7130 Da in grootte en homoloog aan Propionicin Tl, geisoleer vanaf P. thoenii stam 419. Thoeniicin 447 is 'n relatiewe klein, kationiese en hitte-bestande peptied en kan op grond hiervan as 'n lid van die klas II bakteriosiene geklassifiseer word. Hierdie eienskappe is soortgelyk aan die eienskappe van bakteriosiene geproduseer deur melksuurbakterieë. Tot op hede is geen klassifikasiesisteem vir die bakteriosiene van propionibakterieë voorgestel nie. As 'n lid van die genus Propionibacterium, word P. thoenii 447 in die algemeen as veilig beskou. Dit, tesame met die nou spektrum van aktiwiteit, veral teenoor P. acnes, die hittetoleransie van thoeniicin 447, asook die aktiwiteit oor 'n wye pH-grens, maak die peptied geskik vir moontlike farmaseutiese toepassings.
APA, Harvard, Vancouver, ISO, and other styles
9

Bargo, Johnny E. "Mechanical property characterization of recycled thermoplastics." Morgantown, W. Va. : [West Virginia University Libraries], 2000. http://etd.wvu.edu/templates/showETD.cfm?recnum=1473.

Full text
Abstract:
Thesis (M.S.)--West Virginia University, 2000.<br>Title from document title page. Document formatted into pages; contains xvii, 143 p. : ill. (some col.) Includes abstract. Includes bibliographical references (p. 104-105).
APA, Harvard, Vancouver, ISO, and other styles
10

Van, Staden Anton Du Preez. "In vitro and In vivo characterization of Amyloliquecidin, a novel two-component lantibiotic produced by Bacillus amyloliquefaciens." Thesis, Stellenbosch : Stellenbosch University, 2015. http://hdl.handle.net/10019.1/96656.

Full text
Abstract:
Thesis (PhD)--Stellenbosch University, 2015.<br>ENGLISH ABSTRACT: Antimicrobial resistance is one of the major problems faced by the medical industry today. The ability of bacteria to rapidly acquire resistance against antibiotics and the over prescription and inappropriate use of antibiotics further exacerbate this crisis. Few new antimicrobials are, however, making it through the drug discovery pipeline. The search and development of novel and effective antimicrobials is therefore of the utmost importance. Lantibiotics are ribosomally synthesized cationic antimicrobial peptides with extensive post-translational modifications. They are active against a wide range of Gram-positive bacteria, including antibiotic-resistant strains. They are characterized by the presence of lanthionine and methyllanthionine rings and have been suggested as alternatives or for use in conjunction with antibiotics against resistant pathogens. Staphylococcus aureus is the most common bacteria isolated from skin and soft tissue infections (SSTIs). Strains of S. aureus have emerged with resistance against antibiotics with the most common being methicillin-resistant S. aureus (MRSA). Several lantibiotics are active against MRSA in vivo and have even shown superior activity to traditional antibiotics. Lantibiotics therefore show much promise for the treatment of SSTIs caused by resistant- and non-resistant S. aureus. In this study the bacterially diverse soil of the Fynbos in the Western Cape was screened for novel antimicrobials. Two antimicrobial producing Bacillus strains were isolated, Bacillus clausii AD1 and Bacillus amyloliquefaciens AD2. Both of these strains produce lantibiotics with B. clausii AD1 producing a known lantibiotic, clausin. B. amyloliquefaciens AD2 produces a novel two-component lantibiotic which was designated amyloliquecidin. The lantibiotic operon of amyloliquecidin was sequenced and annotated. All the genes required for successful production of amyloliquecidin are present in the operon. Amyloliquecidin was characterized in vitro and along with clausin is active against clinical strains of S. aureus (including MRSA), Enterococcus spp., Listeria spp. and beta-haemolytic streptococci. Amyloliquecidin has remarkable stability at physiological pH compared to nisin and clausin. A comparative in vivo murine infection model was used to evaluate the effectiveness of amyloliquecidin, nisin, clausin and Bactroban (commercial S. aureus topical treatment) in treating wound infections caused by S. aureus. All the lantibiotics proved to be just as effective as the Bactroban treatment. Furthermore, the tested lantibiotics did not have a negative influence on the wound closure rates of infected and non-infected wounds. Bactroban had a negative effect on wound healing compared to the lantibiotics. To our knowledge amyloliquecidin is the third two-component lantibiotic isolated from Bacillus. This study represents the first to test the effectiveness of amyloliquecidin in vivo and is one of a handful to test lantibiotics as topical treatments.<br>AFRIKAANSE OPSOMMING: Antimikrobiese weerstandbiedende bakterieë is op die oomblik een van die grootste probleme in die mediese veld. Die antibiotika krisis word vererg deur die vermoë van bakterieë om vinnig weerstand op te bou teen antibiotika, asook die alledaagse misbruik van antibiotika. Daar is ook ʼn tekort in die hoeveelheid antibiotika wat na die finale fases van ontwikkeling gaan. Om die oorhand teen antibiotika-weerstandige bakterieë te kry is dit van uiterste belang dat meer effektiewe antibiotika ontdek word. Lantibiotika is kationiese antimikrobiese peptiede wat deur die ribosoom gesintetiseer word en bevat ʼn verskeidenheid van modifikasies wat na translasie ingebou word. Hulle word gekarakteriseer deur lanthionien en metiellanthionien ringe. Lantibiotika is aktief teen ʼn verskeidenheid Gram-positiewe bakterieë en kan in kombinasie met antibiotika, of as alternatief gebruik word. Staphylococcus aureus is die mees algemene bakterium wat geassosieer word met vel en sagte weefsel infeksies (VSWIs). Staphylococcus aureus met weerstand teen antibiotika is ook al geïsoleer, die mees algemene weerstandige ras is methisillien-weerstandige S. aureus (MWSA). Lantibiotika is wel aktief teen MWSA in vitro en in vivo, met van hulle wat tot beter aktiwiteit as die voorgeskrewe antibiotika het. Lantibiotika kan dus gebruik word as behandeling vir VSWIs wat veroorsaak word deur weerstandige S. aureus, asook teen nie-weerstandige rasse. In hierdie studie was die bakteriese diverse grond van die Fynbos in die Wes-kaap ondersoek vir bakterieë wat antimikrobiese middels produseer. Twee Bacillus rasse, Bacillus clausii AD1 en Bacillus amyloliquefaciens AD2, wat antimikrobiese middels produseer, is geïsoleer. Bacillus clausii AD1 produseer ʼn bekende lantibiotikum, naamlik clausin. Bacillus amyloliquefaciens AD2 produseer ʼn nuwe twee-komponent lantibiotikum, amyloliquecidin. Die lantibiotikum operon wat verantwoordelik is vir die produksie van amyloliquecidin is geïdentifiseer en geannoteer. Die operon bevat al die gene benodig vir die biosintese van amyloliquecidin. Amyloliquecidin is in vitro gekarakteriseer en het aktiwiteit teen ʼn verskeidenheid Gram-positiewe bakterieë. Amyloliquecidin en clausin is aktief teen S. aureus (insluitend MWSA), Enterococcus spp., Listeria spp. en beta-hemolitiese streptococci wat vanaf infeksies geïsoleer is. Amyloliquecidin is baie stabiel by filologiese pH en aansienlik meer stabiel as nisin en clausin. Die effektiwiteit van nisin, clausin en amyloliquecidin in die behandeling van muis vel infeksies veroorsaak deur S. aureus was vergelyk met die kommersiële behandeling Bactroban. Al drie lantibiotika het die verspreiding van S. aureus met die selfde effektiwiteit as Bactroban belemmer. Geen van die lantibiotika het ʼn negatiewe effek op wond genesing nie. Bactroban, inteendeel, belemmer wond genesing. So ver ons weet is amyloliquecidin die derde twee-komponent lantibiotikum wat uit Bacillus geïsoleer is. Die studie is ook die eerste om die effektiwiteit van amyloliquecidin in vivo te rapporteer, asook ook een van die min studies wat kyk na lantibiotika as behandeling vir topikale infeksies.
APA, Harvard, Vancouver, ISO, and other styles
More sources

Books on the topic "Characterization of producer"

1

Seaforth, C. E. The characterization of plant products. University of the West Indies, 1987.

Find full text
APA, Harvard, Vancouver, ISO, and other styles
2

Gupta, V. K. Extraction, isolation & characterization. Studium Press, 2010.

Find full text
APA, Harvard, Vancouver, ISO, and other styles
3

Amir, Dan. Characterizations of inner product spaces. Birkhäuser Verlag, 1986.

Find full text
APA, Harvard, Vancouver, ISO, and other styles
4

Anson, Omari. Characterization of the parasporal toxin produced by baccillus thuringiensis. Laurentian University, 1985.

Find full text
APA, Harvard, Vancouver, ISO, and other styles
5

Midwest Research Institute (Kansas City, Mo.). Preliminary industry characterization: Wood building products surface coating. U.S. Environmental Protection Agency, Coatings and Consumer Products Group, Emission Standards Division, Office of Air Quality Planning and Standards, 1998.

Find full text
APA, Harvard, Vancouver, ISO, and other styles
6

Shukla, Ashutosh K., ed. Analytical Characterization Methods for Crude Oiland Related Products. John Wiley & Sons Ltd, 2018. http://dx.doi.org/10.1002/9781119286325.

Full text
APA, Harvard, Vancouver, ISO, and other styles
7

Chou, Mei-In Melissa. Characterization of volatile sulfur compounds produced from Illinois coal chars. Illinois State Geological Survey, 1985.

Find full text
APA, Harvard, Vancouver, ISO, and other styles
8

Landis, Geoffrey A. Deposition and characterization of ZnS/Si heterojunctions produced by vaccum evaporation. National Aeronautics and Space Administration, 1989.

Find full text
APA, Harvard, Vancouver, ISO, and other styles
9

Landis, Geoffrey. Deposition and characterization of ZnS/Si heterojunctions produced by vaccum evaporation. National Aeronautics and Space Administration, 1989.

Find full text
APA, Harvard, Vancouver, ISO, and other styles
10

Nzihou, Ange, ed. Handbook on Characterization of Biomass, Biowaste and Related By-products. Springer International Publishing, 2020. http://dx.doi.org/10.1007/978-3-030-35020-8.

Full text
APA, Harvard, Vancouver, ISO, and other styles
More sources

Book chapters on the topic "Characterization of producer"

1

Mayer, Hans, and Urs Hengartner. "Characterization of Products." In Carotenoids. Birkhäuser Basel, 1996. http://dx.doi.org/10.1007/978-3-0348-9323-7_3.

Full text
APA, Harvard, Vancouver, ISO, and other styles
2

Berkowitz, Steven A. "Analytical Characterization." In Biosimilar Drug Product Development. CRC Press, 2017. http://dx.doi.org/10.1201/9781315119878-2.

Full text
APA, Harvard, Vancouver, ISO, and other styles
3

Brown, J. S., T. C. Sauer, M. J. Wade, and J. M. Neff. "Chemical and Toxicological Characterization of Produced Water Freon Extracts." In Produced Water. Springer US, 1992. http://dx.doi.org/10.1007/978-1-4615-2902-6_10.

Full text
APA, Harvard, Vancouver, ISO, and other styles
4

Tellez, Gilbert T., and N. Nirmalakhandan. "Bioreclamation of Oilfield Produced Wastewaters: Characterization and Feasibility Study." In Produced Water. Springer US, 1992. http://dx.doi.org/10.1007/978-1-4615-2902-6_41.

Full text
APA, Harvard, Vancouver, ISO, and other styles
5

Hilfiker, Rolf. "Characterization of Crystalline Products." In Crystallization. Wiley-VCH Verlag GmbH & Co. KGaA, 2013. http://dx.doi.org/10.1002/9783527650323.ch8.

Full text
APA, Harvard, Vancouver, ISO, and other styles
6

Brendehaug, J., S. Johnsen, K. H. Bryne, A. L. Gjøse, T. H. Eide, and E. Aamot. "Toxicity Testing and Chemical Characterization of Produced Water — A Preliminary Study." In Produced Water. Springer US, 1992. http://dx.doi.org/10.1007/978-1-4615-2902-6_20.

Full text
APA, Harvard, Vancouver, ISO, and other styles
7

Jefferis, Roy. "Characterization of Biosimilar Biologics." In Biosimilar Drug Product Development. CRC Press, 2017. http://dx.doi.org/10.1201/9781315119878-4.

Full text
APA, Harvard, Vancouver, ISO, and other styles
8

Horsley, Anthony, and Andrew J. Wrobel. "Characterizations of Long-Run Producer Optimum." In Lecture Notes in Economics and Mathematical Systems. Springer International Publishing, 2016. http://dx.doi.org/10.1007/978-3-319-33398-4_3.

Full text
APA, Harvard, Vancouver, ISO, and other styles
9

Yeung, C. William, Kenneth Lee, and Charles W. Greer. "Microbial Community Characterization of Produced Water from the Hibernia Oil Production Platform." In Produced Water. Springer New York, 2011. http://dx.doi.org/10.1007/978-1-4614-0046-2_18.

Full text
APA, Harvard, Vancouver, ISO, and other styles
10

Mantell, D. A., K. Kunimori, S. B. Ryali, and Gary L. Haller. "Carbon Monoxide Oxidation on Platinum: Coverage Dependence of the Product Internal Energy." In Catalyst Characterization Science. American Chemical Society, 1985. http://dx.doi.org/10.1021/bk-1985-0288.ch039.

Full text
APA, Harvard, Vancouver, ISO, and other styles

Conference papers on the topic "Characterization of producer"

1

Wise, Daniel M., Daniel B. Olsen, and Myoungjin Kim. "Characterization of Methane Number for Producer Gas Blends." In ASME 2013 Internal Combustion Engine Division Fall Technical Conference. American Society of Mechanical Engineers, 2013. http://dx.doi.org/10.1115/icef2013-19221.

Full text
Abstract:
Producer gas, any of a variety of gases generated from biomass gasification, is a renewable gaseous fuel that can be burned in gas engines for power production. Producer gas consists primarily of methane, hydrogen, carbon monoxide, carbon dioxide, and nitrogen. These gas blends can be problematic as a fuel for natural gas engines due to widely varying composition and significantly different fuel properties than natural gas. Characterization of combustion properties of different producer gas compositions is critical if the gas engine is to be operated reliably and at the greatest efficiency possible. A sample space of 35 producer gas blends consisting of distinct percentages of combustible gases (methane, hydrogen, and carbon monoxide) and diluent (carbon dioxide and nitrogen) is created to provide a basis for methane number testing. A test cell is established to mix producer gas blends of desired constituent makeup for consumption in a Waukesha F2 Cooperative Fuel Research (CFR) engine to directly measure methane number for each blend. Additional measurements include combustion pressure statistics, fuel consumption, and power output. Methane number is correlated to combustion pressure statistics and producer gas properties. Methane number measurements are compared with predictions using the software AVL Methane, often employed by engine manufacturers to characterize gaseous fuels. Measured methane number shows a strong correlation to 0–10% and 10–90% burn durations. The predicted methane number values from AVL Methane are significantly different than measured methane number in many cases. The error in the prediction is strongly dependent on the amount of carbon monoxide and hydrogen in the producer gas.
APA, Harvard, Vancouver, ISO, and other styles
2

Shi, Yunye, Tejasvi Sharma, and Albert Ratner. "Characterization of Real Time Producer Gas Generation From Paper Sludge Gasification." In ASME 2013 International Mechanical Engineering Congress and Exposition. American Society of Mechanical Engineers, 2013. http://dx.doi.org/10.1115/imece2013-63986.

Full text
Abstract:
Biomass Gasification is incomplete combustion of biomass resulting in production of combustible gases consisting of Carbon monoxide (CO), Hydrogen (H2) and traces of Methane (CH4), the mixture of which is called producer gas. Producer gas can be cleaned and directly used in internal combustion engines or can be converted to various attractive biofuels. The paper sludge is a byproduct produced from recycled cardboard and into pallets. This paper is focused on gasification of paper sludge and its real-time gas evolution through this process. Variables include temperature; equivalence ratio and superficial velocity were tested and analyzed. Results demonstrate that CO2 and H2 formation is favored at higher temperature and higher oxygen concentrations. CO production is ruled by oxidation and water shift reactions but it is difficult to determine from two single variables.
APA, Harvard, Vancouver, ISO, and other styles
3

Jangale, Vilas V., Alexei Saveliev, Serguei Zelepouga, Vitaly Gnatenko, and John M. Pratapas. "Heating Value Sensor for Producer Gas." In ASME 2011 Internal Combustion Engine Division Fall Technical Conference. ASMEDC, 2011. http://dx.doi.org/10.1115/icef2011-60197.

Full text
Abstract:
Today, producer gas is being utilized as a fuel gas in boilers, internal combustion engines and turbines for heat and power generation. The composition of producer gas varies depending upon the gasification parameters. For improved process control and optimum utilization of these heat and power generating systems, it is desirable to monitor the producer gas composition in real-time. A new method and apparatus has been developed and lab-tested for quantitative characterization of producer gas. Spectroscopic and non-spectroscopic measurements are performed in order to detect both — spectrally active and inactive gases. Both methods are cross-sensitive to more than one gas. The measurements are then processed using multivariate statistical methods — principal components regression and partial least squares to fit a regression model which correlates the experimental measurements to the composition and heating value of producer gas. The fitted regression model is used to estimate the properties of unknown mixtures. The measurements and data processing are done in real time using a high speed hardware control and data acquisition system. A commercialized version of this sensor is expected to cost less than half the price of gas chromatographs, which are widely used in the gas industry today.
APA, Harvard, Vancouver, ISO, and other styles
4

Singdahlsen, Donald S., and M. T. Kramer. "3‐D seismic reservoir characterization for the independent producer, Sooner Unit, Weld County, Colorado." In SEG Technical Program Expanded Abstracts 1994. Society of Exploration Geophysicists, 1994. http://dx.doi.org/10.1190/1.1822859.

Full text
APA, Harvard, Vancouver, ISO, and other styles
5

Kugel, Karin, Peter Brennecke, Stefan Steyer, Detlef Gruendler, Wilma Boetsch, and Claudia Haider. "Characterization of Radioactive Wastes With Respect to Harmful Materials." In ASME 2013 15th International Conference on Environmental Remediation and Radioactive Waste Management. American Society of Mechanical Engineers, 2013. http://dx.doi.org/10.1115/icem2013-96134.

Full text
Abstract:
In addendum 4 to the license of the German KONRAD repository, which considers mainly radiological aspects, a water law permit was issued in order to prevent the pollution of the near-surface groundwater. The water law permit stipulates limitations for 10 radionuclides and 2 groups of radionuclides as well as mass limitations for 94 substances and materials relevant for water protection issues. Two collateral clauses, i.e. additional requirements imposed by the licensing authority, include demands on the monitoring, registering and balancing of non-radioactive harmful substances and materials /1/. In order to fulfill the requirements of the water law permit the German Federal Office for Radiation Protection (BfS) being the operator of the KONRAD repository has developed a concept, which ensures the compliance with all requirements of the water law permit and which provides standardized easy manageable guidance for the waste producers to describe their wastes. On 15 March 2011 the competent water authority, the “Niedersaechsischer Landesbetrieb fuer Wasserwirtschaft, Kuesten- und Naturschutz” (NLWKN) issued the approval for this concept. Being the most essential part of this concept the procedural method and the developed description of non-radioactive waste package constituents by use of standardized lists of materials and containers is addressed and presented in this paper. The waste producer has to describe his waste package in a standardized way on the base of the lists of materials and containers. For each material in the list a comprehensive description is given comprising the composition, scope of application, quality control measures, thresholds and other data. Each entry in the list has to be approved by NLWKN. The scope of the lists is defined by the waste producers’ needs. Using some particular materials as examples, the approval procedure for including materials in the list is described. The procedure of describing the material composition has to be considered in the KONRAD waste acceptance requirements. The respective part of these requirements will be introduced. In order to clarify the procedure of describing waste packages by use of the standardized lists of materials and containers some examples of typical waste package descriptions will be presented.
APA, Harvard, Vancouver, ISO, and other styles
6

Maitra, Debajyoti, and Phani P. Gudipati. "Stainless Steel Extrusions and Product Properties for High Pressure-High Temperature (HPHT) Applications." In ASME 2018 Symposium on Elevated Temperature Application of Materials for Fossil, Nuclear, and Petrochemical Industries. American Society of Mechanical Engineers, 2018. http://dx.doi.org/10.1115/etam2018-6704.

Full text
Abstract:
Extrusion process produces semi-finished product that provides significant savings in machining and fabrication of the finished components. Plymouth Engineered Shapes (PES) employs forward extrusion techniques to produce products up to 40 feet long that are utilized in power generation, nuclear, and petrochemical applications where it is critical to meet or exceed ASME piping, boiler and pressure vessels code specifications. The extrusion process has been successfully employed to manufacture components such as various types of valve bodies, manifolds, adapters and more that are targeted for elevated temperature applications up to 1200°F and under high pressures up to 10,000 PSIG. Critical product characteristics include flatness, straightness, twist, angularity, surface quality and dimensions over the full length. This paper presents an overview of the carbon steel and stainless steel extrusion process, the room temperature and elevated temperature mechanical properties, metallographic characterization, testing requirements and the applications of such products. Properties are also be compared to those produced by the conventional hot rolling and forging operations.
APA, Harvard, Vancouver, ISO, and other styles
7

Carrizo, Nicolas, Emiliano Santiago, and Pablo Saldungaray. "AN INTEGRATED PETROPHYSICAL CHARACTERIZATION OF A SILICICLASTIC TIGHT GAS RESERVOIRS IN NEUQUÉN BASIN, WESTERN ARGENTINA." In 2021 SPWLA 62nd Annual Logging Symposium Online. Society of Petrophysicists and Well Log Analysts, 2021. http://dx.doi.org/10.30632/spwla-2021-0044.

Full text
Abstract:
The Río Neuquén field is located thirteen miles north west of Neuquén city, between Neuquén and Río Negro provinces, Argentina. Historically it has been a conventional oil producer, but some years ago it was converted to a tight gas producer targeting deeper reservoirs. The targeted geological formations are Lajas, which is already a known tight gas producer in the Neuquén basin, and the less known overlaying Punta Rosada formation, which is the main objective of the current work. Punta Rosada presents a diverse lithology, including shaly intervals separating multiple stacked reservoirs that grade from fine-grained sandstones to conglomerates. The reservoir pressure can change from the normal hydrostatic gradient to up to 50% of overpressure, there is little evidence of movable water. The key well in this study has a comprehensive set of open hole logs, including NMR and pulsed-neutron spectroscopy data, and it is supported by a full core study over a 597ft section in Punta Rosada. Additionally, data from several offset wells were used, containing sidewall cores and complete sets of electrical logs. This allowed to develop rock-calibrated mineral models, adjusting the clay volume with X-ray diffraction data, porosity and permeability with confined core measurements, and link the logs interpretation to dominant pore throat radius models from MICP Purcell tests at 60,000 psi. Several water saturation models were tested attempting to adjust the irreducible water saturation with NMR and Purcell tests at reservoir conditions. As a result, three hydraulic units were defined and characterized, identifying a strong correlation with lithofacies observed in cores and image logs. A cluster analysis model allowed the propagation of the facies to the rest of the wells (50). Finally, lithofacies were distributed in a full-field 3D model, guided by an elastic seismic inversion. In the main key well, in addition to the open hole logs and core data, a cased hole pulsed neutron log (PNL) was also acquired , which was used to develop algorithms to generate synthetic pseudo open hole logs such as bulk density and resistivity, integrated with the spectroscopy mineralogical information and other PNL data to perform the petrophysical evaluation. This enables the option to evaluate wells in contingency situations where open hole logs are not possible or are too risky, and also in planned situations to replace the open hole data in infill wells, saving considerable drilling rig time to reduce costs during this field development phase. Additionally, the calibrated cased hole model can be used in old wells already drilled and cased in the Punta Rosada formation. This paper explores the integration of different core and log measurements and explains the development of rock-calibrated petrophysical and rock types models for open and cased hole logs addressing the characterization challenges found in tight gas sand reservoirs. The results of this study will be crucial to optimize the development of a new producing horizon in a mature field.
APA, Harvard, Vancouver, ISO, and other styles
8

Chen, Hongquan, Deepthi Sen, Akhil Datta-Gupta, and Masahiro Nagao. "Model-Free Assessment of Inter-Well Connectivity in CO2 WAG Projects Using Statistical Recurrent Unit Models." In SPE Annual Technical Conference and Exhibition. SPE, 2021. http://dx.doi.org/10.2118/205944-ms.

Full text
Abstract:
Abstract Routine well-wise injection and production measurements contain significant information on subsurface structure and properties. Data-driven technology that interprets surface data into subsurface structure or properties can assist operators in making informed decisions by providing a better understanding of field assets. Our machine-learning framework is built on the statistical recurrent unit (SRU) model and interprets well-based injection/production data into inter-well connectivity without relying on a geologic model. We test it on synthetic and field-scale CO2 EOR projects utilizing the water-alternating-gas (WAG) process. SRU is a special type of recurrent neural network (RNN) that allows for better characterization of temporal trends, by learning various statistics of the input at different time scales. In our application, the complete states (injection rate, pressure and cumulative injection) at injectors and pressure states at producers are fed to SRU as the input and the phase rates at producers are treated as the output. Once the SRU is trained and validated, it is then used to assess the connectivity of each injector to any producer using permutation variable importance method, wherein inputs corresponding to an injector are shuffled and the increase in prediction error at a given producer is recorded as the importance (connectivity metric) of the injector to the producer. This method is tested in both synthetic and field-scale cases. The validation of the proposed data-driven inter-well connectivity assessment is performed using synthetic data from simulation models where inter-well connectivity can be easily measured using the streamline-based flux allocation. The SRU model is shown to offer excellent prediction performance on the synthetic case. Despite significant measurement noise and frequent well shut-ins imposed in the field-scale case, the SRU model offers good prediction accuracy, the overall relative error of the phase production rates at most producers ranges from 10% to 30%. It is shown that the dominant connections identified by the data-driven method and streamline method are in close agreement. This significantly improves confidence in our data-driven procedure. The novelty of this work is that it is purely data-driven method and can directly interpret routine surface measurements to intuitive subsurface knowledge. Furthermore, the streamline-based validation procedure provides physics-based backing to the results obtained from data analytics. The study results in a reliable and efficient data analytics framework that is well-suited for large field applications.
APA, Harvard, Vancouver, ISO, and other styles
9

Molie`re, Michel, Elvio Panarotto, Maher Aboujaib, et al. "Gas Turbines in Alternative Fuel Applications: Biodiesel Field Test." In ASME Turbo Expo 2007: Power for Land, Sea, and Air. ASMEDC, 2007. http://dx.doi.org/10.1115/gt2007-27212.

Full text
Abstract:
As fuel candidates for power generation are mushrooming worldwide, there is presently a surge of interest around liquid biofuels that form a large and contrasting family. Among biofuels, biodiesels are natural candidates due to their compatibility with gasoil and their increasing use in the transportation sector. While biodiesels are similar to gasoils in terms of physical data, both their chemical properties and combustion behavior can be markedly different. In the framework of a development program devoted to biofuels and in collaboration with the Swiss power producer Groupe E, GE Energy has carried out a preliminary characterization of the combustion and emissions of a FAME (fatty acid methyl ester) at the Cornaux power plant, canton of Neuchaˆtel. This Field Test has been performed in a Frame 6B equipped with standard combustors and involved both a pure FAME consisting of RME (rapeseed methyl ester) and FAME co-fired with natural gas.
APA, Harvard, Vancouver, ISO, and other styles
10

Mohd Ismail, Ismarullizam, Vidar Mathiesen, Anson Abraham, Ehsan Ranjbar, Faraj Zarei, and Jeremy Walter. "An Innovative Modelling Approach in Characterization of Autonomous Inflow Control Valve Performance to Maximizing Oil Recovery in Heavy Oil-SAGD Application." In SPE Thermal Integrity and Design Symposium. SPE, 2021. http://dx.doi.org/10.2118/203859-ms.

Full text
Abstract:
Abstract Flow control devices (FCDs) have demonstrated significant potential in improving recovery from Steam Assisted Gravity Drainage (SAGD) production wells. Passive FCDs will allow the SAGD producer well to create additional pressure drop to balance the production influx, improving overall conformance and promoting accelerated hydrocarbon production. However, passive FCDs cannot effectively restrict steam effluents once steam breakthrough at the production well occurs. The Autonomous Inflow Control Valve (AICV) actively delivers a dynamic flow restriction with the ability to choke and/or ‘shut-off’ in response to the associated viscosity and density of the fluids flowing through the AICV. This novel AICV design behaves truly autonomously based on the Hagen-Poiseuille equation and Bernoulli’s principle. The AICV utilizes the differences in flow behaviour between the laminar and turbulent flow restrictions to differentiate the pressure-drops between oil, water, gas, and steam phases. A collaborative effort has been initiated between the AICV vendor and the Computer Modelling Group to develop reservoir simulation workflows with the AICV that will allow the user to enter characteristic performance curves for a variety of SAGD and thermal fields. The development of mechanistic wellbore modelling and developed methodology to incorporate the associated complexities of AICV behaviour has shown to be an improvement to the way FCDs are currently modelled, providing insight into the potential for AICV application in SAGD and other thermal recovery operations. Such techniques allow the reservoir simulation tools to perform realistic predictions of the AICV behaviour at downhole conditions and evaluate scenarios and relative impacts of completion designs. The development of a new characterization method of AICV performance in SAGD applications, and its implementation in reservoir simulation tools, has helped to unveil the benefits of implementing AICVs in improving recovery from SAGD operations.
APA, Harvard, Vancouver, ISO, and other styles

Reports on the topic "Characterization of producer"

1

Yeh, H. C., B. A. Muggenburg, D. L. Lundgren, et al. Characterization of aerosols produced by surgical procedures. Office of Scientific and Technical Information (OSTI), 1994. http://dx.doi.org/10.2172/10185619.

Full text
APA, Harvard, Vancouver, ISO, and other styles
2

Bostick, D. T. Characterization of Soluble Organics in Produced Water. Office of Scientific and Technical Information (OSTI), 2002. http://dx.doi.org/10.2172/814231.

Full text
APA, Harvard, Vancouver, ISO, and other styles
3

Park, John J., and Michael Press. Characterization of BRCA1 Protein Product. Defense Technical Information Center, 2000. http://dx.doi.org/10.21236/ada392318.

Full text
APA, Harvard, Vancouver, ISO, and other styles
4

Jenkins, R. A., C. W. Nestor, C. V. Thompson, et al. Characterization of rocket propellant combustion products. Office of Scientific and Technical Information (OSTI), 1991. http://dx.doi.org/10.2172/5712917.

Full text
APA, Harvard, Vancouver, ISO, and other styles
5

Singhvi, Punit, Javier García Mainieri, Hasan Ozer, and Brajendra Sharma. Rheology-Chemical Based Procedure to Evaluate Additives/Modifiers Used in Asphalt Binders for Performance Enhancements: Phase 2. Illinois Center for Transportation, 2021. http://dx.doi.org/10.36501/0197-9191/21-020.

Full text
Abstract:
The increased use of softer binders in Illinois over the past decade is primarily attributed to the increased use of recycled materials in asphalt pavement construction. The shift in demand of using PG 58-28 over PG 64-22 has resulted in potential alternative methods to produce softer binders more economically using proprietary products. However, there are challenges in using these proprietary products for asphalt modification because of uncertainty in their long-term performance and significant variability in binder chemistry. The current SuperPave performance grading specification for asphalt binders is insufficient in differentiating binders produced from these modifiers. Therefore, the objective of this study is to evaluate the performance of various softener-type asphalt binder modifiers using a wide array of rheological and chemistry tests for their integration into the Illinois Department of Transportation’s material specifications. The small-strain rheological tests and their parameters allowed for consistent grouping of modified binders and can be used as surrogates to identify performing and nonperforming asphalt binders. A new parameter, Δ|G*|peak τ, was developed from the linear amplitude sweep test and showed potential to discriminate binders based on their large-strain behavior. Chemistry-based parameters were shown to track aging and formulation changes. The modifier sources were identified using fingerprint testing and were manifested in the modified binder chemical and compositional characteristics. The two sources of base binders blended with the modifiers governed the aging rate of the modified binders. Mixture performance testing using the Illinois Flexibility Index Test and the Hamburg Wheel-Track Test were consistent with the rheological and chemical findings, except for the glycol amine-based modified binder, which showed the worst cracking performance with the lowest flexibility index among the studied modifiers. This was contrary to its superior rheological performance, which may be attributed to lower thermal stability, resulting in high mass loss during mixing. According to the characterization of field-aged binders, laboratory aging of two pressurized aging vessel cycles or more may represent realistic field aging of 10 to 15 years at the pavement surface and is able to distinguish modified binders. Therefore, an extended aging method of two pressurized aging vessel cycles was recommended for modified binders. Two different testing suites were recommended for product approval protocol with preliminary thresholds for acceptable performance validated with field-aged data.
APA, Harvard, Vancouver, ISO, and other styles
6

Park, John J., and Michael Press. Characterization of the BRCAl Protein Product. Defense Technical Information Center, 1999. http://dx.doi.org/10.21236/ada382528.

Full text
APA, Harvard, Vancouver, ISO, and other styles
7

Farnand, B., P. M. Rahimi, and S. A. Fouda. Characterization of naphtha produced from coprocessing coal-heavy oil. Natural Resources Canada/ESS/Scientific and Technical Publishing Services, 1986. http://dx.doi.org/10.4095/302673.

Full text
APA, Harvard, Vancouver, ISO, and other styles
8

Beaux, Miles Frank, and Igor Olegovich Usov. Characterization of Thin Walled Mo Tubing produced by FBCVD. Office of Scientific and Technical Information (OSTI), 2016. http://dx.doi.org/10.2172/1237235.

Full text
APA, Harvard, Vancouver, ISO, and other styles
9

Rue, D. M., and M. J. Roberts. Characterization of asphalt additive produced from hydroretorted Alabama shale. Office of Scientific and Technical Information (OSTI), 1992. http://dx.doi.org/10.2172/10177361.

Full text
APA, Harvard, Vancouver, ISO, and other styles
10

Rycroft, Taylor, Kerry Hamilton, Charles Haas, and Igor Linkov. A quantitative risk assessment method for synthetic biology products in the environment. Engineer Research and Development Center (U.S.), 2021. http://dx.doi.org/10.21079/11681/41331.

Full text
Abstract:
The need to prevent possible adverse environmental health impacts resulting from synthetic biology (SynBio) products is widely acknowledged in both the SynBio risk literature and the global regulatory community. However, discussions of potential risks of SynBio products have been largely speculative, and the attempts to characterize the risks of SynBio products have been non-uniform and entirely qualitative. As the discipline continues to accelerate, a standardized risk assessment framework will become critical for ensuring that the environmental risks of these products are characterized in a consistent, reliable, and objective manner that incorporates all SynBio-unique risk factors. Current established risk assessment frameworks fall short of the features required of this standard framework. To address this, we propose the Quantitative Risk Assessment Method for Synthetic Biology Products (QRASynBio) – an incremental build on established risk assessment methodologies that supplements traditional paradigms with the SynBio risk factors that are currently absent and necessitates quantitative analysis for more transparent and objective risk characterizations. The proposed framework facilitates defensible quantification of the environmental risks of SynBio products in both foreseeable and hypothetical use scenarios. Additionally, we show how the proposed method can promote increased experimental investigation into the likelihood of hazard and exposure parameters and highlight the parameters where uncertainty should be reduced, leading to more targeted risk research and more precise characterizations of risk.
APA, Harvard, Vancouver, ISO, and other styles
You might also be interested in the extended bibliographies on the topic 'Characterization of producer' for particular source types:
Journal articles Dissertations / Theses Books
We offer discounts on all premium plans for authors whose works are included in thematic literature selections. Contact us to get a unique promo code!

To the bibliography