Journal articles: 'Schwarzkopf'

1

Baxter, R. "Elisabeth Schwarzkopf: The Beginning of a Legend * Elisabeth Schwarzkopf Recital 1." Opera Quarterly 22, no. 1 (December 13, 2006): 195–200. http://dx.doi.org/10.1093/oq/kbi090.

Full text

APA, Harvard, Vancouver, ISO, and other styles

2

Barrow, Logie. "Jutta Schwarzkopf, 1953–2016." History Workshop Journal 84 (2017): 295–99. http://dx.doi.org/10.1093/hwj/dbx019.

Full text

APA, Harvard, Vancouver, ISO, and other styles

3

Kater, M. H. "Book Review: Elisabeth Schwarzkopf." German History 16, no. 3 (July 1, 1998): 472–74. http://dx.doi.org/10.1177/026635549801600341.

Full text

APA, Harvard, Vancouver, ISO, and other styles

4

Aman, Mohammed M. "General H. Norman Schwarzkopf: The Autobiography: It Doesn't Take a Hero; H. Norman Schwarzkopf with Peter Petre." Digest of Middle East Studies 2, no. 2 (April 1993): 90–94. http://dx.doi.org/10.1111/j.1949-3606.1993.tb00951.x.

Full text

APA, Harvard, Vancouver, ISO, and other styles

5

Hennipman, P. "An Old Case of Plagiarism: Pierson Eclipsed by Schwarzkopf." History of Political Economy 22, no. 3 (September 1, 1990): 539–44. http://dx.doi.org/10.1215/00182702-22-3-539.

Full text

APA, Harvard, Vancouver, ISO, and other styles

6

Hömberg, Walter. "Vordenker des öffentlichen Rundfunks. Zum 80. Geburtstag von Dietrich Schwarzkopf." Communicatio Socialis 40, no. 2 (2007): 181–83. http://dx.doi.org/10.5771/0010-3497-2007-2-181.

Full text

APA, Harvard, Vancouver, ISO, and other styles

7

Clarke, Francis, Yuri Ledyaev, and Maria do Rosário de Pinho. "An Extension of the Schwarzkopf Multiplier Rule in Optimal Control." SIAM Journal on Control and Optimization 49, no. 2 (January 2011): 599–610. http://dx.doi.org/10.1137/09078047x.

Full text

APA, Harvard, Vancouver, ISO, and other styles

8

Berkowitz, Bruce D. "It doesn't Take a hero: General H. Schwarzkopf, the autobiography." Orbis 37, no. 2 (March 1993): 300. http://dx.doi.org/10.1016/0030-4387(93)90240-d.

Full text

APA, Harvard, Vancouver, ISO, and other styles

9

Bohrmann, Hans. "Dietrich Schwarzkopf (Hrsg.): Rundfunkpolitik in Deutschland. Wettbewerb und Öffentlichkeit. München 1999." Medien & Kommunikationswissenschaft 48, no. 3 (2000): 416–17. http://dx.doi.org/10.5771/1615-634x-2000-3-416.

Full text

APA, Harvard, Vancouver, ISO, and other styles

10

Zöllner, Oliver. "Dietrich Schwarzkopf (Hrsg.): Rundfunkpolitik in Deutschland. Wettbewerb und Öffentlichkeit. 2 Teilbände." Publizistik 46, no. 1 (March 2001): 98–101. http://dx.doi.org/10.1007/s11616-001-0027-0.

Full text

APA, Harvard, Vancouver, ISO, and other styles

11

Kapur, Narinder. "Remembering norman schwarzkopf: evidence for two distinct long-term fact learning mechanisms." Cognitive Neuropsychology 11, no. 6 (December 1994): 661–70. http://dx.doi.org/10.1080/02643299408251988.

Full text

APA, Harvard, Vancouver, ISO, and other styles

12

Herrmann, Stephanie. "Optimale Bedürfnisbefriedigung der Konsumenten durch Category Management — Category Management bei Schwarzkopf & Henkel." Thexis 23, no. 2 (May 2006): 8–10. http://dx.doi.org/10.1007/bf03249106.

Full text

APA, Harvard, Vancouver, ISO, and other styles

13

Landwehr, Charlotte. "Alexandra Schwarzkopf, Die deutsche Stammzelldebatte. Eine exemplarische Untersuchung bioethischer Normenkonflikte in der politischen Kommunikation der Gegenwart." Medizinrecht 33, no. 1 (January 2015): 76. http://dx.doi.org/10.1007/s00350-014-3888-8.

Full text

APA, Harvard, Vancouver, ISO, and other styles

14

Klein, C., A. Wehrend, R. Weiss, and H. Bostedt. "Eitrig-ulzerierende Vestibulovaginitis und Myometritis bei hochgraviden Schafen, verursacht durch Clostridium perfringens Typ A." Tierärztliche Praxis Ausgabe G: Großtiere / Nutztiere 35, no. 03 (2007): 192–96. http://dx.doi.org/10.1055/s-0037-1621637.

Full text

Abstract:

Zusammenfassung Gegenstand: Beschreibung einer Vulvitis in Verbindung mit einer eitrig-ulzerierenden Vestibulovaginitis und der Schwellung des perivulvären Bereichs bei hochtragenden Deutsch-Schwarzkopf-Schafen. Material und Methode: Fallbeschreibung bei zwei Schafen. Ergebnisse: Die 3,5 Jahre alten Schafe eines Bestandes wiesen ein erheblich gestörtes Allgemeinbefinden bis hin zum Festliegen in Seitenlage auf. Zwei weitere Tiere im Bestand waren bereits an denselben Erscheinungen verstorben. Die mikrobiologische Untersuchung von Tupferproben aus dem Vestibulum vaginae und der Oberfläche der Labien ergab den Nachweis von Clostridium (C.) perfringens Typ A. Die sofort eingeleiteten Therapiemaßnahmen führten nur bei einem der beiden Schafe zur Heilung. Das zweite Tier musste trotz intensiver Therapie intra partum euthanasiert werden. Die Sektion des Tierkörpers bestätigte das Vorliegen einer ausgeprägten eitrig-ulzerierenden Vestibulovaginitis sowie einer Myometritis. Nicht nur aus Proben von der Vaginalschleimhaut, sondern auch in Probenmaterialien aus dem Uteruslumen sowie aus allen großen Parenchymen ließ sich ein hochgradiger Gehalt von C. perfringens Typ A nachweisen. Schlussfolgerung und klinische Relevanz: Dies ist nach unserem Wissensstand die erste Beschreibung eines von C. perfringens Typ A verursachten Gasgangräns im vulvovestibulovaginalen Bereich und dem Uterus bei hochgraviden Schafen.

APA, Harvard, Vancouver, ISO, and other styles

15

Gonzalez, Avelino J., Brian Sherwell, Johann Nguyen, Brian C. Becker, Víctor Hung, and Patrick Brezillon. "A Knowledge Preservation and Re-Use Tool Based on Context-Driven Reasoning." International Journal on Artificial Intelligence Tools 24, no. 05 (October 2015): 1550020. http://dx.doi.org/10.1142/s0218213015500207.

Full text

Abstract:

This article describes a knowledge preservation and re-use tool designed to capture the knowledge of a specific individual at the US National Science Foundation, for later retrieval by successors after his retirement. The system is designed in a Q&A format, where it is sufficiently intelligent to ask for clarifying questions. The primary objective was to create a system that would result in acceptance of the system by the users. The domain of interest to be preserved and re-used was programmatic knowledge about the NSF Industry/University Collaborative Research Centers (I/UCRC) Program, and more specifically, the knowledge of its long-time director, Dr. Alex Schwarzkopf. The system is called AskAlex and it uses a trio of techniques to accomplish its objectives. Contextual graphs (CxG) are used as the basic knowledge representation structure. CxG’s are assisted by a search engine and an ontology of terms to help find the proper contextual graph that can best answer the question being asked. Evaluations with users and potential users generally confirm our selection and provided some guidance for improvements in the system.

APA, Harvard, Vancouver, ISO, and other styles

16

Finn, Margot C. "Jutta Schwarzkopf. Women in the Chartist Movement. New York: St. Martin's Press. 1991. Pp. viii, 337. $49.95." Albion 24, no. 4 (1992): 680–81. http://dx.doi.org/10.2307/4050711.

Full text

APA, Harvard, Vancouver, ISO, and other styles

17

Muehlbauer, Matthew S. "On War and Leadership: The Words of Combat Commanders from Frederick the Great to Norman Schwarzkopf (review)." Journal of Military History 67, no. 1 (2003): 288–89. http://dx.doi.org/10.1353/jmh.2003.0060.

Full text

APA, Harvard, Vancouver, ISO, and other styles

18

Spiller, Ronald L. "On War and Leadership: The Words of Combat Commanders from Frederick the Great to Norman Schwarzkopf (review)." Journal of Military History 70, no. 3 (2006): 829–30. http://dx.doi.org/10.1353/jmh.2006.0199.

Full text

APA, Harvard, Vancouver, ISO, and other styles

19

Cherevko, Kateryna, Myroslava Zhyshkovych, Ruslana Kalyn, and Ivanna Komarevych. "Master class as a leading pedagogical technology in professional improvement of individual performing qualities of singers." Revista Amazonia Investiga 10, no. 47 (December 17, 2021): 282–92. http://dx.doi.org/10.34069/ai/2021.47.11.29.

Full text

Abstract:

The purpose of this article is to identify and clarify the pedagogical perspectives of a master class as a leading teaching method that actively influences the process of forming and improving the professional level of singers. The practice of individuating of the educational process in music pedagogy is based on the cooperation of all participants and is aimed at developing musical abilities and individual skills of performers. Master classes play an important role in the improvement of vocalists’ professional skills and provide active spreading of performing and pedagogical experience in the world. This article describes the history of master classes as a special teaching technique in music education, examines and analyzes the peculiarities of conducting vocal master classes by prominent singers: Thomas Quasthoff, Тномas Hampson, Jerzy Artysz, Ursula Schongals, Elisabeth Schwarzkopf, Montserrat Caballé, Mirella Freni, Joyce DiDonato at.al. Master classes open new ways to raise the level of performer's skills, and thus are the key to further successful development of singer’s career. Therefore, the master class is an effective pedagogical technology in the professional growth of individual performing qualities of singers of different ages and different levels of vocal-technique and performing skills.

APA, Harvard, Vancouver, ISO, and other styles

20

Hill, Fred. "The Gulf Conflict." American Journal of Islam and Society 14, no. 3 (October 1, 1997): 93–95. http://dx.doi.org/10.35632/ajis.v14i3.2278.

Full text

Abstract:

Writers have compared the media frenzy of the Gulf War to the coverage ofa football game. Critics noted the pep rally atmosphere created by journalists(Charles Osgood's description of US bombing as a "marvel"; Dan Rather's"Congratulations on a job wonderfully done."). A Chicago Tribune cartoon portrayedSaudi and Kuwaiti emirs in luxury boxes awaiting the war, heckling Bush to “Throw the bomb!” Perhaps it was that pause in the second week of thebombing, allowing most US soldiers to watch the Super Bowl, but Americansdid seem to confuse the war with a sporting event. Both features perceived goodguys and bad guys, satisfying but guilt-free violence, little sympathy for thecasualties . . . and plenty of cheerleaders.Books about the Gulf War extend this comparison to sports coverage. Afterthe big game, our fist wave of analysts report from postgame interviews. Theseare generally shallow and simplistic, breathless with elation and self-glory.Comparable books on the Gulf War, including biographies of Schwarzkopf,Powell, and Bush, now cram the discount tables at the large booksellers. Insports, the second wave of analysts, back in the studio, offer somewhat meatierexplanations and more subtle rationalizations for the events just reported. Theiremotions are thinly concealed in a semblance of objectivity ...

APA, Harvard, Vancouver, ISO, and other styles

21

LEONHARD-MAREK, S., M. MAREK, and H. MARTENS. "Effect of transmural potential difference on Mg transport across rumen epithelium from four different breeds of sheep." Journal of Agricultural Science 130, no. 2 (March 1998): 241–47. http://dx.doi.org/10.1017/s0021859697005200.

Full text

Abstract:

Increasing the dietary intake of K reduces the Mg absorption from the forestomachs of ruminants by decreasing the apical membrane potential and increasing the transepithelial potential difference (Vt). To evaluate genetic variations in the dependence of Mg absorption on K intake, we performed Ussing chamber experiments and studied the effect of Vt on 28Mg fluxes across rumen epithelium from different breeds of sheep. All breeds showed net absorption of Mg (JMgnet) in the absence of electrochemical gradients. JMgnet of Skudde was lower compared to Merino or Schwarzkopf sheep. Increasing Vt decreased mucosal to serosal Mg flux (JMgms) and increased serosal to mucosal Mg flux. The effect of Vt on JMgnet was almost identical in all breeds of sheep (−30 to −45% for a 25 mV increase in Vt). The effect of Vt on JMgms revealed a Vt-dependent and a Vt-independent component of transcellular Mg absorption in all breeds. Considering the driving forces for these two Mg transport mechanisms, the effect of K on Mg absorption will mainly depend on the feeding regimen, i.e. dietary K must have a relatively higher effect on Mg absorption at low Mg intake levels, which explains the correlation between pasture quality and tetany frequency as well as the missing effect of K on Mg status in some older studies.

APA, Harvard, Vancouver, ISO, and other styles

22

Niewiarowski, Peter H., and Arthur E. Dunham. "Effects of Mortality Risk and Growth on a Model of Reproductive Effort: Why the Shine and Schwarzkopf Model is Not General." Evolution 52, no. 4 (August 1998): 1236. http://dx.doi.org/10.2307/2411255.

Full text

APA, Harvard, Vancouver, ISO, and other styles

23

Masum, Hassan. "Review of Computational Geometry: Algorithms and Applications (2nd ed.) by Mark de Berg, Marc van Kreveld, Mark Overmars, and Otfried Schwarzkopf." ACM SIGACT News 31, no. 4 (December 2000): 10–12. http://dx.doi.org/10.1145/369836.571192.

Full text

APA, Harvard, Vancouver, ISO, and other styles

24

Niewiarowski, Peter H., and Arthur E. Dunham. "EFFECTS OF MORTALITY RISK AND GROWTH ON A MODEL OF REPRODUCTIVE EFFORT: WHY THE SHINE AND SCHWARZKOPF MODEL IS NOT GENERAL." Evolution 52, no. 4 (August 1998): 1236–41. http://dx.doi.org/10.1111/j.1558-5646.1998.tb01852.x.

Full text

APA, Harvard, Vancouver, ISO, and other styles

25

Mai, Manfred. "Dietrich Schwarzkopf: Zwischen Anspruch und Akzeptanz. Der öffentliche Rundfunk im Wandel. Beiträge aus dreißig Jahren. Herausgegeben und eingeleitet von Walter Hömberg." Publizistik 52, no. 3 (September 2007): 433. http://dx.doi.org/10.1007/s11616-007-0205-9.

Full text

APA, Harvard, Vancouver, ISO, and other styles

26

Szász, Róbert. "A Sivatagi Vihar tapasztalatai 30 év távlatában." Honvédségi Szemle 149, no. 5 (September 6, 2021): 141–49. http://dx.doi.org/10.35926/hsz.2021.5.11.

Full text

Abstract:

Mintegy 30 évvel ezelőtt, Kuvait 1990-es iraki megszállásának idején – dacára a második világháború óta megvívott csaták tapasztalatai alapján kiadott irányelveknek – az amerikai fegyveres erők különböző szintű vezetői és szakértői még mindig azon vitáztak, hogy mi is a légierő szerepe egy összhaderőnemi műveletben. A „szárazföld” berkeiben népszerű elmélet alapján – amit szerintük az 1980-as években kiadott AirLand Battle doktrína is alátámasztott – a légierő kizárólagosan a szárazföldi erők támogatására hivatott. A problémát mélyítette, hogy a légierő egyes vezetői – köztük a Harcászati Légi Parancsnokság (Tactical Air Command, ma Air Combat Command) akkori parancsnoka, Robert D. Russ tábornok – szintén támogatták ezt a nézetet. A légierő doktrínákkal foglalkozó szakértői szerint azonban az AirLand Battle doktrína csak a szárazföldi repülőerőkre (Army Aviation) vonatkozik, és nem a légierőre. A másik oldal egyik jeles képviselője John A. Warden III ezredes – a Pentagon akkori egyik hírhedt/híres elemzője – volt, aki szerint a légierő a többi haderőnem támogatásával akár fő szerepet is játszhat egy összhaderőnemi műveletben. Az elméleticsatározások természetesen nem sok hatással lehettek volna a kuvaiti válságra, ha az annak megoldásával megbízott Központi Parancsnokság (CENTCOM2) parancsnoka, H. Norman Schwarzkopf tábornok mint főparancsnok (JFC3) és Charles A. Horner tábornok, a CENTCOM légierő komponensének parancsnoka (JFACC4) nem jutnak arra a következtetésre, hogy ezt a háborút csak a légierő újszerű alkalmazásával tudják hatékonyan megvívni. A tanulmány szerzője a több mint három évtizeddel ezelőtti események felidézésén és elemzésén túlmenően igyekszik levonni azok máig ható tanulságait is.

APA, Harvard, Vancouver, ISO, and other styles

27

Alexie, Sherman. "In Response to Elizabeth Cook-Lynn's Pronouncement That I One of the New, Angry (Warriors) Kind of like Norman Schwarzkopf and Rush Limbaugh." Wicazo Sa Review 9, no. 2 (1993): 9. http://dx.doi.org/10.2307/1409178.

Full text

APA, Harvard, Vancouver, ISO, and other styles

28

Crisp, David, Stephen B. Fels, and M. D. Schwarzkopf. "Correction to “Approximate methods for finding CO215-μm band transmission in planetary atmospheres” by David Crisp, Stephen B. Fels, and M. D. Schwarzkopf." Journal of Geophysical Research 92, no. D10 (1987): 12021. http://dx.doi.org/10.1029/jd092id10p12021.

Full text

APA, Harvard, Vancouver, ISO, and other styles

29

Müller, Marion G. "Hans-Dieter Schütt/Oliver Schwarzkopf (Hrsg.): Die SPIEGEL-Titelbilder 1947–1999. Mit einem Vorwort von Rudolf Augstein und einem Gespräch mit Stefan Aust." Publizistik 47, no. 3 (September 2002): 352–53. http://dx.doi.org/10.1007/s11616-002-0098-6.

Full text

APA, Harvard, Vancouver, ISO, and other styles

30

Schwarzkopf, Sarah, Asako Kinoshita, Jeannette Kluess, Susanne Kersten, Ulrich Meyer, Korinna Huber, Sven Dänicke, and Jana Frahm. "Correction: Schwarzkopf et al. Weaning Holstein Calves at 17 Weeks of Age Enables Smooth Transition from Liquid to Solid Feed. Animals 2019, 9, 1132." Animals 11, no. 11 (October 25, 2021): 3044. http://dx.doi.org/10.3390/ani11113044.

Full text

APA, Harvard, Vancouver, ISO, and other styles

31

Gutfrucht, Manfred, Hans-Gerd Haugwitz, Stefan Schmitz, and Klaus Wecker. "Project to bypass the Schwarzkopf Tunnel - Specialised civil engineering for a core project of Deutsche Bahn AG / Bauvorhaben Umfahrung Schwarzkopftunnel - Spezialtiefbau für ein Kernprojekt der Deutschen Bahn AG." Geomechanics and Tunnelling 8, no. 2 (April 2015): 146–54. http://dx.doi.org/10.1002/geot.201510012.

Full text

APA, Harvard, Vancouver, ISO, and other styles

32

Davis, Aeron. "Response to Stefan Schwarzkopf's Review Essay." Journal of Cultural Economy 8, no. 6 (December 11, 2014): 730–33. http://dx.doi.org/10.1080/17530350.2014.982153.

Full text

APA, Harvard, Vancouver, ISO, and other styles

33

Ali, S., O. Espin-Garcia, A. Wong, P. Potla, C. Pastrello, M. Mcintyre, S. Lively, I. Jurisica, R. Gandhi, and M. Kapoor. "POS0230 THE miR-320 FAMILY IS UPREGULATED IN FAST-PROGRESSING RADIOGRAPHIC KNEE OSTEOARTHRITIS: DATA FROM THE OSTEOARTHRITIS INITIATIVE." Annals of the Rheumatic Diseases 81, Suppl 1 (May 23, 2022): 351.1–352. http://dx.doi.org/10.1136/annrheumdis-2022-eular.2970.

Full text

Abstract:

BackgroundThere is an outstanding need for prognostic biomarkers to reliably detect fast-progressing knee osteoarthritis (OA) such that preventative interventions can be targeted to this patient population. MicroRNA-sequencing is an unbiased approach for comprehensive profiling of circulating microRNAs in liquid biopsies to discover novel biomarkers of disease. As negative regulators of gene expression, microRNAs hold potential not only as biomarkers, but also as mechanistic drivers of knee OA.ObjectivesTo apply microRNA-sequencing to identify unique circulating microRNAs as potential biomarkers that distinguish fast-progressing radiographic knee OA from both slow- and non-progressing radiographic knee OA.MethodsLeveraging the Osteoarthritis Initiative (OAI) longitudinal cohort, we applied our customized microRNA-sequencing pipeline [1] to blood plasma samples collected at both baseline and 4-year follow-up from 106 participants. The disease trajectory for each participant was constructed by plotting their Kellgren-Lawrence (KL) grades over an 8-year follow-up period. Based on these trajectories, we defined fast-progression as an increase from KL 0/1 at baseline to KL 3/4 by 4-year follow-up, slow-progression as an increase from KL 0/1 at baseline to KL 2/3/4 by 8-year follow-up, and non-progression as no increase from KL0/1 at baseline throughout the 8-year follow-up. Following differential expression analysis, we assessed predictive performance and identified putative gene targets for prioritized microRNAs.ResultsComparing fast-progressors to both slow-progressors and non-progressors, we identified differentially expressed microRNAs within timepoints (i.e., 48 microRNAs at baseline and 2 microRNAs at 4-year follow-up) and across timepoints. Among these microRNAs were four members of the miR-320 family, with miR-320d showing an increase in fast-progressors at both timepoints, compared to both slow- and non-progressors. The predictive models we constructed included miR-320 members and had good accuracy (area under the receiver operating characteristic curves ranging from 82.6 to 91.9) in distinguishing fast-progressors. Putative gene targets of the miR-320 family included members of the 14-3-3 gene family (Table 1), including YWHAE, whose downregulation in OA cartilage was reported to promote deterioration [2].Table 1.Predicted gene targets of the miR-320 family include members of the 14-3-3 gene family.14-3-3 gene family memberhsa-miR-320bhsa-miR-320chsa-miR-320dhsa-miR-320eSFNMMMLYWHABMMMMYWHAEVVVHYWHAGVVVMYWHAHVVVMYWHAQVVVMYWHAZVVVMAll mirDIP results with bold text indicating the prediction was among the top 1% for that microRNA/gene target pair. Letters denote the mirDIP score class with V=very high, H=high, M=medium, and L=low.ConclusionThis microRNA-sequencing study is the first of its kind, profiling circulating microRNAs at two timepoints in 106 participants with data-driven construction of knee OA trajectories. We identify the miR-320 family of microRNAs to be associated with fast-progressing radiographic knee OA over time. While our data suggest this microRNA family could have applications as prognostic biomarkers for knee OA, and could be regulating gene targets to impact OA severity, validation of these findings in independent longitudinal cohorts is required.References[1]Potla P, Ali SA, Kapoor M. A bioinformatics approach to microRNA-sequencing analysis. Osteoarthritis and Cartilage Open. 2021;3(1):100131. doi: https://doi.org/10.1016/j.ocarto.2020.100131.[2]Fu W, Hettinghouse A, Chen Y, Hu W, Ding X, Chen M, Ding Y, Mundra J, Song W, Liu R, Yi YS, Attur M, Samuels J, Strauss E, Leucht P, Schwarzkopf R, Liu CJ. 14-3-3 epsilon is an intracellular component of TNFR2 receptor complex and its activation protects against osteoarthritis. Ann Rheum Dis. 2021 Dec;80(12):1615-1627. doi: 10.1136/annrheumdis-2021-220000.Disclosure of InterestsNone declared

APA, Harvard, Vancouver, ISO, and other styles

34

Gutman, Josef Maxwell, Kelvin Kim, Ran Schwarzkopf, and Ilya Kister. "Total Hip and Knee Arthroplasty in Patients with Multiple Sclerosis." International Journal of MS Care 20, no. 5 (September 1, 2018): 244–50. http://dx.doi.org/10.7224/1537-2073.2017-093.

Full text

Abstract:

CME/CNE Information Activity Available Online: To access the article, post-test, and evaluation online, go to http://www.cmscscholar.org. Target Audience: The target audience for this activity is physicians, physician assistants, nursing professionals, and other health-care providers involved in the management of patients with multiple sclerosis (MS). Learning Objectives: Accreditation Statement: In support of improving patient care, this activity has been planned and implemented by the Consortium of Multiple Sclerosis Centers (CMSC) and Delaware Media Group. CMSC is jointly accredited by the Accreditation Council for Continuing Medical Education (ACCME), the Accreditation Council for Pharmacy Education (ACPE), and the American Nurses Credentialing Center (ANCC), to provide continuing education for the healthcare team. Physician Credit The CMSC designates this journal-based activity for a maximum of 0.5 AMA PRA Category 1 Credit(s)™. Physicians should claim only the credit commensurate with the extent of their participation in the activity. Nurse Credit The CMSC designates this enduring material for 0.5 contact hours (none in the area of pharmacology). Disclosures: Editor in Chief of the International Journal of MS Care (IJMSC), has served as Physician Planner for this activity. He has disclosed no relevant financial relationships.Francois Bethoux, MD, has served as reviewer for this activity. She has disclosed no relevant financial relationships.Laurie Scudder, DNP, NP, has disclosed no relevant financial relationships.Josef Maxwell Gutman, MD, has disclosed no relevant financial relationships.Kelvin Kim, BA, has received consulting fees from Smith & Nephew and Intelijoint that are unrelated to this work.Ran Schwarzkopf, MD, MSc, served on the scientific advisory boards for Biogen and Genentech and received research support from the Guthy-Jackson Charitable Foundation, National Multiple Sclerosis Society, Biogen, EMD Serono, Genzyme, and Novartis.Ilya Kister, MD, One peer reviewer for the IJMSC has received consulting fees from Biogen, Sanofi Genzyme, Ibsen Pharmaceutical, and Teva and has done contracted research for Astellas, Merck, and Biogen. The other peer reviewer has disclosed no relevant financial relationships. The staff at the IJMSC, CMSC, and Delaware Media Group who are in a position to influence content have disclosed no relevant financial relationships. Note: Disclosures listed for authors are those applicable at the time of their work on this project and within the previous 12 months. Method of Participation: Release Date: October 1, 2018 Valid for Credit Through: October 1, 2019 In order to receive CME/CNE credit, participants must: Statements of Credit are awarded upon successful completion of the post-test with a passing score of >70% and the evaluation. There is no fee to participate in this activity. Disclosure of Unlabeled Use: This educational activity may contain discussion of published and/or investigational uses of agents that are not approved by the FDA. CMSC and Delaware Media Group do not recommend the use of any agent outside of the labeled indications. The opinions expressed in the educational activity are those of the faculty and do not necessarily represent the views of CMSC or Delaware Media Group. Disclaimer: Participants have an implied responsibility to use the newly acquired information to enhance patient outcomes and their own professional development. The information presented in this activity is not meant to serve as a guideline for patient management. Any medications, diagnostic procedures, or treatments discussed in this publication should not be used by clinicians or other health-care professionals without first evaluating their patients' conditions, considering possible contraindications or risks, reviewing any applicable manufacturer's product information, and comparing any therapeutic approach with the recommendations of other authorities.

APA, Harvard, Vancouver, ISO, and other styles

35

Radic, Prvoslav. "On the external standardization of the language of Serbs." Juznoslovenski filolog, no. 64 (2008): 365–83. http://dx.doi.org/10.2298/jfi0864365r.

Full text

Abstract:

The weakening of the SFRY (Socialist Federative Republic of Yugoslavia) which was followed by its dissolution, had an impact on a wide range of issues, one of them being the degradation of the so called Serbo-Croatian language. Not only did the external political influences contribute to the dissolution of the SFRY, but they also play a part in the linguistic profiling of new standard varieties today. However, as the dissolution of Yugoslavia couldn't have been imagined without consequences for Serbs primarily, the transformation of the 'Serbo-Croatian' language into a series of new language norms-successors of the old ones, cannot take place without challenging the rights of the great number of Serbs who live outside of Serbia. These are the rights that primarily refer to the linguistic and social identity - therefore the national identity. The best illustration of this are the external influences in the domain of linguistic engineering today, and these influences can basically be divided into extensive (e. g. commercials, radio and TV programmes) and intensive (textbooks, handbooks etc). The aim of this study is the analysis of those different kinds of pressures put on the standard variety of the language of Serbs. From the domain of the extensive influences (commercials) there is an example of the instruction given on a tube of toothpaste (Vademecum laboratories, Perfection 5 - Schwarzkopf & Henkel, Dusseldorf - Germany), and as an example of the intensive influences of this type, there is an American textbook (R. Alexander, E. Elias-Bursa} Bosnian, Croatian, Serbian, a Textbook, With Exercises and Basic Grammar, The University of Wisconsin Press, 2006). Both of these language materials proved to be highly compatible when it comes to the characteristics that should become an integral part of the standard language variety of Serbs, and apparently only the Serbs who live in Serbia. Among the language characteristics which are 'typically Serbian' the most prominent are: ekavian dialect ('lepa deca', not: 'lijepa djeca'), the 'da + prezent' construction ('moram da citam', not: 'moram citati'), the prepositional form 'sa' ('sa limunom', not: 's limunom'), as well as many other characteristics like interrogative sentences beginning with da li ('Da li si student?', not 'Jesi li student?') etc. As it follows the newly formed political borders in the area of the former SFRY, the contemporary linguistic engineering has engaged itself in creation of the new standard language varieties, including the one (or should we say, primarily the one) that belongs to the Serbs. However, the Serbs don't have the need for the re-standardization of their language (which became widely familiar to the European community since the 17th century, and it underwent the process of standardization at the beginning of the 19th century owing to the work of Vuk Karadzic) after the dissolution of SFRY, especially if it would be carried out from the outside and not take into account all the entities of this nation, e. g. the Serbs in Croatia, Bosnia and Herzegovina, Montenegro etc. Because it is those Serbs who have always contributed significantly to the culture, science, and the overall identity of the Serbs generally, doing an immense favor to the European and even the world culture, and science in general. That is why the European culture - if it seeks to remain multiethnic and democratic - and other cultures similar to her, must allow the Serbs to preserve their cultural and national identity, wherever they may live - and the best proof of this will be its attitude towards the standard language variety which was established by Serbs almost two centuries ago.

APA, Harvard, Vancouver, ISO, and other styles

36

Broaddus, Jane B. "Cades Cove: The Life and Death of a Southern Appalachian Community, 1818–1937. By Durwood Dunn, The Appalachian National Scenic Trail: A Time to Be Bold. By Charles H. W. Foster, A History of Mount Mitchell and the Black Mountains: Exploration, Development, and Preservation. By S. Kent Schwarzkopf." Forest & Conservation History 33, no. 2 (April 1989): 93–94. http://dx.doi.org/10.2307/4005107.

Full text

APA, Harvard, Vancouver, ISO, and other styles

37

Masri, Bassam A. "Commentary on Articles by David H. Kim, MD, et al.: “Institutional Prescreening for Detection and Eradication of Methicillin-Resistant Staphylococcus aureus in Patients Undergoing Elective Orthopaedic Surgery” and by Ran Schwarzkopf, MD, MS, et al.: ”Prevalence of Staphylococcus aureus Colonization in Orthopaedic Surgeons and Their Patients. A Prospective Cohort Controlled Study”." Journal of Bone and Joint Surgery-American Volume 92, no. 9 (August 2010): e10(1)-e10(2). http://dx.doi.org/10.2106/jbjs.j.00788.

Full text

APA, Harvard, Vancouver, ISO, and other styles

38

Zhu, Litao, Milan Konečný, Jie Shen, Zdeněk Stachoň, and Hana Švedová. "The Influence of Spatial Familiarity on Landmark Salience Sensibility Based on Eye Tracking." Abstracts of the ICA 1 (July 15, 2019): 1–2. http://dx.doi.org/10.5194/ica-abs-1-438-2019.

Full text

Abstract:

Abstract. Landmarks play an important role in navigation especially when people in the familiar and unfamiliar environment. These landmarks are usually used for expressing their spatial knowledge. This prior knowledge is related to the spatial familiarity that the spatial knowledge is acquired by individuals as a function of their experience in the environment (Gale et al., 1990). Individuals prefers to take into highly account their familiar route within the environment. Furthermore, the route descriptions include the differed types of landmarks in familiar/unfamiliar routes (Lovelace et al., 1999). The user’s level of spatial familiarity for people is a key factor of how they navigate in the environment (Savage et al., 2012). In human navigation or wayfinding, the dependency on familiar landmarks is the highest priority (Golledge, 2003).Landmarks are more distinguishably salient and prominent than the another spatial features (Sorrows and Hirtle, 1999). Therefore, the landmark salience refers to how easily this prominent spatial feature can be regarded as a landmark (Raubal and Winter, 2002). The landmark salience mainly divided into visual, structural (important location), and cognitive (semantic). Visual salience refers to the visual characteristics of spatial features such as color contrast with surroundings. Some visual characteristics include facade areas, shapes, colors and other properties. Semantic salience refers to the spatial knowledge related features such as a cultural importance of building. Structural salience refers to the spatial features play an important role in the structure of the spatial environment.The level of spatial knowledge of the individual also an important factor in landmark selection (Nuhn and Timpf, 2018). Hamburger and Röser (2014) investigated landmark semantics and showed that famous buildings were better recognized than unfamiliar ones. Quesnot and Roche (2015) found that the familiar individuals prefer the semantic landmarks in environment while the unfamiliar individuals prefer the landmark with the prominent visual and structural. In contrast, people unfamiliar with an environment prefer landmarks with outstanding visual and structural characteristics.The existing literature studies the method that landmark indicators to be considered are not comprehensive while can’t reflect on the landmark characteristics. The reason is that the method of calculation and extraction for landmarks can’t conform the individual preference needs of navigation. Compared with the traditional subjective evaluation method, the eye-tracking method provide objectivity and reliability. For example, a mobile eye tracking system was used by Kiefer et al. (2014) to investigate the process of self-localization. They discovered that test persons directed their attention longer on landmarks on the map and aligned them with objects in the surroundings during successful localization of their own position. Schwarzkopf et al. (2013) used fixed and mobile eye tracking devices to study that participates selected the navigation landmarks in the virtual environment and the real-world of the airport. In general, there are an only limited number of works related to the influence of spatial familiarity on landmark by using eye tracking method.At present, many navigation systems are providing users with route directions under different travel modes. These navigation systems have the "distance-to-turn" method in route directions, however the landmark knowledge has not been conformed to user's habits and spatial cognitive in wayfinding. In order to solve these problems, this paper aims to study the characteristics of the user’s spatial familiarity and landmark salience evaluation method in navigation. The following questions are addressed in this study: 1) What’s the relationship between the spatial familiarity with the landmark selection in navigation for individuals? 2) What is the quantitative evaluation model to connect between the spatial familiarity with the landmark salience by using the eye-tracking data?In our experiments, we will use eye tracking to explore the influence of spatial familiarity on landmark salience. The experimental path is part of the campus area of Nanjing Normal University. The subjects are divided into novice students and senior students from Nanjing Normal University as unfamiliar and familiar groups respectively. The procedures are divided into two parts, namely, the subjects should walk the experimental path within the fixation time and then they are asked to wear VR eye tracking module a Glass DK II special for HTC view (China; https://www.7invensun.com/) to do three types of tasks about landmark picture with the characteristics of visual, semantic and structural. With this research, we expect to establish a landmark salience evaluation method through eye movement data and analyse the landmark selection rules of groups with different spatial familiarity. It is helpful to design the pedestrian navigation system based on landmarks, improve the pertinence and reliability of navigation services and reduce the cognitive load for users.

APA, Harvard, Vancouver, ISO, and other styles

39

Loftus, Donna. ": Tim Barringer ,Men at Work: Art and Labour in Victorian Britain(New Haven and London: Yale University Press, 2005), 392 pages, hardback, $65 (ISBN 0300103808); John Albert Walker ,Work: Ford Madox Brown's Painting and Victorian Life(London: Francis Boutle, 2006), 132 pages, hardback, £22 (ISBN 1903 42729 0); Jutta Schwarzkopf ,Unpicking Gender: The Social Construction of Gender in the Lancashire Cotton Weaving Industry, 1880–1914(Aldershot: Ashgate, 2004), 228 pages, £55 (ISBN 9780754609803)." Journal of Victorian Culture 12, no. 2 (October 2007): 360–65. http://dx.doi.org/10.3366/jvc.2007.12.2.360.

Full text

APA, Harvard, Vancouver, ISO, and other styles

40

Krones, Hartmut. "Elisabeth Schwarzkopf." Österreichische Musikzeitschrift 41, no. 2 (January 1986). http://dx.doi.org/10.7767/omz.1986.41.2.92b.

Full text

APA, Harvard, Vancouver, ISO, and other styles

41

Ludwig, Anja. "Pauline Schwarzkopf." Stiftung&Sponsoring, no. 5 (October 1, 2010). http://dx.doi.org/10.37307/j.2366-2913.2010.05.07.

Full text

APA, Harvard, Vancouver, ISO, and other styles

42

Sutton, David. "Schwarzkopf in 'Nam." Kinema: A Journal for Film and Audiovisual Media, September 22, 1998. http://dx.doi.org/10.15353/kinema.vi.865.

Full text

Abstract:

During the summer of 1993, CBS News aired an hour-long television special program entitled Schwarzkopf in Vietnam: A Soldier Returns. This program, hereafter referred to as SVN:ASR, featured a return trip to Southeast Asia by retired US Army General H. Norman Schwarzkopf and CBS News personality Dan Rather, both of whom served in different capacities in Southeast Asia during the war years. Their current trip to Vietnam was the first time either person had been back to Indochina since the end of the war in April 1975. First and foremost, we must recognize that this particular program is a commodity. SVN:ASR was broadcast on network television, which like any other commercial enterprise exists to make a profit. Viewing this artifact at face value, the program appeared to be strictly informative -- a televised lesson in American military history given by a well-known military figure. One could reasonably surmise that the network...

APA, Harvard, Vancouver, ISO, and other styles

43

"Government Reference Serials. LeRoy C. Schwarzkopf." Library Quarterly 59, no. 3 (July 1989): 282–83. http://dx.doi.org/10.1086/602151.

Full text

APA, Harvard, Vancouver, ISO, and other styles

44

Palmer, Bruce. "But It Does Take a Leader: The Schwarzkopf Autobiography." US Army War College Quarterly: Parameters 23, no. 1 (July 4, 1993). http://dx.doi.org/10.55540/0031-1723.1672.

Full text

APA, Harvard, Vancouver, ISO, and other styles

45

"General H. Norman Schwarzkopf to keynote IPC SMEMA Council's APEX." Circuit World 25, no. 4 (December 1999). http://dx.doi.org/10.1108/cw.1999.21725dab.004.

Full text

APA, Harvard, Vancouver, ISO, and other styles

46

Cowling, N. M. "IT DOESN'T TAKE A HERO; GEN H. NORMAN SCHWARZKOPF - THE AUTOBIOGRAPHY." Scientia Militaria - South African Journal of Military Studies 25, no. 1 (February 14, 2012). http://dx.doi.org/10.5787/25-1-267.

Full text

APA, Harvard, Vancouver, ISO, and other styles

47

"Warrior's words: a quotation book from Sesostris III to Schwarzkopf 1871BC to AD1991." Choice Reviews Online 30, no. 07 (March 1, 1993): 30–3598. http://dx.doi.org/10.5860/choice.30-3598.

Full text

APA, Harvard, Vancouver, ISO, and other styles

48

"IPC. IPC to 'storm' the shores of Long Beach with General H. Norman Schwarzkopf." Soldering & Surface Mount Technology 11, no. 3 (December 1999). http://dx.doi.org/10.1108/ssmt.1999.21911cab.012.

Full text

APA, Harvard, Vancouver, ISO, and other styles

49

"Jutta Schwarzkopf. Women in the Chartist Movement. New York: St. Martin's. 1991. Pp. viii, 337. $49.95." American Historical Review, February 1993. http://dx.doi.org/10.1086/ahr/98.1.166.

Full text

APA, Harvard, Vancouver, ISO, and other styles

50

Breczku, Anna Mária. "Eco-conscious and green consumption of FMCG hair care products in Pest County, Hungary." Prosperitas, 2022, 1–15. http://dx.doi.org/10.31570/prosp_2022_0013.

Full text

Abstract:

This research examines Hungarian customers’ eco-conscious consumption in the sector of Fast-Moving Consumer Goods, namely hair care products. The research provides an introduction to eco-consciousness and sustainability and discusses climate change and controversial opinions on plastic packaging. To receive a wider overview of the behaviour of customers, questions have been formed to lead the research. For instance, how open Hungarian consumers are to sustainable consumption, how much are they influenced by the knowledge they have about environmental problems and climate change, and what changes they have already made to develop eco-conscious purchasing habits. To reach enough participants, the researcher used a questionnaire and analysed its answers in an attempt to answer the research questions. For obtaining more personal and deeper opinions, the research had several personal interviews with participants from different age and gender groups, and asked them about their habits, regarding the consumption of eco-conscious hair care consumption. Furthermore, the researcher also had an interview with a member of Schwarzkopf Professional Hungary. The results of the research reveal that consumers exhibit a high-level environmental awareness, and they are conscious of their purchasing habits, but they lack the motivation to make changes in their purchasing habits. On the other hand, price is an important factor in decision-making, thus there is a lack of sustainable options to choose from.

APA, Harvard, Vancouver, ISO, and other styles

Journal articles on the topic 'Schwarzkopf'

Create a spot-on reference in APA, MLA, Chicago, Harvard, and other styles