Log in

Relevant bibliographies by topics / T3 (Triiodothyronine) / Journal articles

To see the other types of publications on this topic, follow the link: T3 (Triiodothyronine).

Journal articles on the topic 'T3 (Triiodothyronine)'

Author: Grafiati

Published: 3 June 2025

Last updated: 31 July 2025

Create a spot-on reference in APA, MLA, Chicago, Harvard, and other styles

Select a source type:

Consult the top 50 journal articles for your research on the topic 'T3 (Triiodothyronine).'

Next to every source in the list of references, there is an 'Add to bibliography' button. Press on it, and we will generate automatically the bibliographic reference to the chosen work in the citation style you need: APA, MLA, Harvard, Chicago, Vancouver, etc.

You can also download the full text of the academic publication as pdf and read online its abstract whenever available in the metadata.

Browse journal articles on a wide variety of disciplines and organise your bibliography correctly.

1

Peterson, Mark E., Thomas K. Graves, and David A. Gamble. "Triiodothyronine (T3) Suppression Test." Journal of Veterinary Internal Medicine 4, no. 5 (1990): 233–38. http://dx.doi.org/10.1111/j.1939-1676.1990.tb03114.x.

Full text

APA, Harvard, Vancouver, ISO, and other styles

2

Young, Diane W., James L. Sartin, and Robert J. Kemppainen. "Abnormal canine triiodothyronine-binding factor characterized as a possible triiodothyronine autoantibody." American Journal of Veterinary Research 46, no. 6 (1985): 1346–50. https://doi.org/10.2460/ajvr.1985.46.06.1346.

Full text

Abstract:

SUMMARY Of more than 6,000 canine serum samples submitted to the Endocrine Diagnostic Laboratory of the School of Veterinary Medicine, Auburn University, Ala, for thyroid evaluation in 1983, 18 contained an abnormal triiodothyronine (T3)-binding factor (T3BF). These samples were easily distinguished from non-T3BF containing samples because the factor interfered with the radioimmunoassay for total T3 resulting in a profound increase in apparent values for T3 concentration. Most of the T3BF-containing samples did not have unusual thyroxine binding or inappropriate thyroxine concentrations.Triiod

APA, Harvard, Vancouver, ISO, and other styles

3

Sapin, Rémy. "Triiodothyronine (T3) totale et libre." EMC - Biologie Médicale 1, no. 1 (2006): 1–6. http://dx.doi.org/10.1016/s2211-9698(06)76132-5.

Full text

APA, Harvard, Vancouver, ISO, and other styles

4

Troshina, E. A., and E. S. Senyushkina. "Metabolic Systemic Effects Triiodothyronine." Russian Archives of Internal Medicine 10, no. 4 (2020): 262–71. http://dx.doi.org/10.20514/2226-6704-2020-10-4-262-271.

Full text

Abstract:

Triiodothyronine (T3, 3,5,3’-L-triiodothyronine) is a thyroid hormone (thyroid), the secretion of which is carried out directly both by the gland (to a lesser extent) and outside it (the main amount; as a result of peripheral deiodination of thyroxine (T4)). Getting into the nuclei of cells, T3 interacts with specific nuclear receptors of target tissues, which determines its biological activity. This interaction leads to the activation of transcription of a number of genes.In the pituitary gland and peripheral tissues, the action of thyroid hormones is modulated by local deiodinases, which con

APA, Harvard, Vancouver, ISO, and other styles

5

Fan, Lu, Athanasia Warnecke, Julia Weder, Matthias Preller, and Carsten Zeilinger. "Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site." International Journal of Molecular Sciences 23, no. 13 (2022): 7150. http://dx.doi.org/10.3390/ijms23137150.

Full text

Abstract:

Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.

APA, Harvard, Vancouver, ISO, and other styles

6

Tan, Theresa M. C., and Kim Ping Wong. "Hepatic sulphate conjugation of triiodothyronine (T3)." Biochemical Pharmacology 37, no. 14 (1988): 2859–62. http://dx.doi.org/10.1016/0006-2952(88)90051-2.

Full text

APA, Harvard, Vancouver, ISO, and other styles

7

Lowe, John C., Richard L. Garrison, Alan Reichman, and Jackie Yellin. "Triiodothyronine (T3) Treatment of Euthyroid Fibromyalgia." Clinical Bulletin of Myofascial Therapy 2, no. 4 (1997): 71–88. http://dx.doi.org/10.1300/j425v02n04_05.

Full text

APA, Harvard, Vancouver, ISO, and other styles

8

Katzeff, H. L., D. Bovbjerg, and D. A. Mark. "Exercise regulation of triiodothyronine metabolism." American Journal of Physiology-Endocrinology and Metabolism 255, no. 6 (1988): E824—E828. http://dx.doi.org/10.1152/ajpendo.1988.255.6.e824.

Full text

Abstract:

Negative caloric balance reduces triiodothyronine (T3) production in both humans and rodents. The effects of chronic voluntary exercise and various levels of caloric intake and balance on T3 metabolism were studied in adult male C57/BL6 mice to determine if exercise had any direct effects on T3 production in vivo and in vitro. Chronic voluntary exercise was induced by the addition of running wheels to cages for 28 days. Ad libitum-fed exercising mice ingested 20% greater calories (P less than 0.02), maintained body weight, and increased T3 production (53.1 +/- 5.3 vs. 42.3 +/- 3.4 ng.h-1.100 m

APA, Harvard, Vancouver, ISO, and other styles

9

Isozaki, Osamu, Toshio Tsushima, Kanji Sato, et al. "Triiodothyronine binding immunoglobulin in a euthyroid man without apparent thyroid disease; its properties and effects on triiodothyronine metabolism." Acta Endocrinologica 108, no. 4 (1985): 498–503. http://dx.doi.org/10.1530/acta.0.1080498.

Full text

Abstract:

Abstract. A 54 year old man with markedly elevated serum T3, but without an apparent thyroid disease, was found to have a specific antibody to T3. His serum thyroxine, TBG and TSH were in normal range, but T3-RSU was markedly low. Antibodies to thyroglobulin and microsome were negative. He was judged euthyroid because of a normal basal metabolic rate and a normal thyroidal 123I uptake which was suppressed by T3 adminnistration. When serum was extracted with ethanol prior to assay, serum T3 was found to be in the upper border of normal range. Several experiments revealed the presence of an anti

APA, Harvard, Vancouver, ISO, and other styles

10

Karapitta, Christina D., Theodore G. Sotiroudis, Athanassios Papadimitriou, and Aristotelis Xenakis. "Homogeneous Enzyme Immunoassay for Triiodothyronine in Serum." Clinical Chemistry 47, no. 3 (2001): 569–74. http://dx.doi.org/10.1093/clinchem/47.3.569.

Full text

Abstract:

Abstract Background: The concentration of triiodothyronine (T3) in human serum is extremely low and can be determined only by very sensitive methods. We developed a homogeneous enzyme immunoassay for T3 analysis in unextracted serum. Methods: A T3 derivative was conjugated to the −SH groups of glycogen phosphorylase b (GPb) from rabbit muscle. Conjugation caused inhibition of enzyme activity, and the enzyme conjugate was reactivated upon binding of anti-T3 antibody. Activation was blocked by the presence of non-antibody-bound T3; this was the basis for the development of the homogeneous enzyme

APA, Harvard, Vancouver, ISO, and other styles

11

Faber, Jens, Carsten Kirkegaard, Bo Jørgensen, and Jørgen Kludt. "The hidden, nonexchangeable pool of 3,5,3'-triiodothyronine and 3,3',5'-triiodothyronine in man: does it exist?" Acta Endocrinologica 120, no. 5 (1989): 667–71. http://dx.doi.org/10.1530/acta.0.1200667.

Full text

Abstract:

Abstract. The validity of estimation of the production rates of T3 and rT3 in man based on noncompartmental analysis of blood-derived data has been questioned owing to incomplete exchangeability of T3 and rT3 between plasma and extrathyroidal tissues in which a local production of these iodothyronines takes place. The possible existence of a nonexchangeable or hidden pool of T3 and rT3 would result in an underestimation of the daily production. By contrast, the production rate of T4 can be estimated reliably using noncompartmental analysis. We have studied 16 women with pretreatment severe hyp

APA, Harvard, Vancouver, ISO, and other styles

12

Tokmakjian, Sonya D., D. S. Milton Haines, and Merril W. Edmonds. "Interference in assay of free triiodothyronine by triiodothyronine-binding antibodies." Clinical Chemistry 37, no. 12 (1991): 2150. http://dx.doi.org/10.1093/clinchem/37.12.2150.

Full text

Abstract:

Abstract A 39-year-old woman with a 20-year history of hypothyroidism caused by Hashimoto thyroiditis had been managed adequately with oral thyroxun (T4), 200 mg/day, until a few months before referral, at which time she developed symptoms of hyperthyroidism. Her thyroid hormone proffle at the time of referral is shown in Table 1 (Sample 1). Her normal value for serum thyrotropin (TSH) concentration indicates that she was euthyreid but, because of the high serum triiodothyronune (T3) value, the daily oral doseof T4 was decreased to 100 mg. The serum thyroid tests were repeated four weeks later

APA, Harvard, Vancouver, ISO, and other styles

13

SULTAN, JAHANGIR, TARIQ AFZAL, and KOKAB JABEEN. "ENDOGENOUS DEPRESSION;." Professional Medical Journal 20, no. 04 (2013): 595–99. http://dx.doi.org/10.29309/tpmj/2013.20.04.1124.

Full text

Abstract:

Objective: The aim of this study to determine the levels of Total triiodothyronine (T3) in patients with first episode ofEndogenous depression (prior to medical treatment) and in matched controls. Setting: Punjab Institute of Mental Health. Period: BetweenJan. and Dec.2011. Material & Methods: 100 newly diagnosed depressive patients in the age range of 18-65 years were included in thestudy. 60 healthy controls were taken from dermatological clinic. Total triiodothyronine (T3) was estimated using enzyme - immunoassay. The results obtained were analyzed using Statistical package of social sc

APA, Harvard, Vancouver, ISO, and other styles

14

Morin, Anna K. "Triiodothyronine (T3) supplementation in major depressive disorder." Mental Health Clinician 5, no. 6 (2015): 253–59. http://dx.doi.org/10.9740/mhc.2015.11.253.

Full text

Abstract:

Abstract Introduction The use of thyroid hormones to enhance the effects of antidepressants is based on evidence supporting a link between thyroid function and Major Depressive Disorder. Thyroid abnormalities have been found in patients with Major Depressive Disorder and have been correlated with depression severity. Symptoms associated with clinical hypothyroidism include mood disturbances, primarily depression. In addition, an increase in antidepressant treatment resistance has been associated with thyroid abnormalities. This article reviews the existing data regarding triiodothyronine (T3)

APA, Harvard, Vancouver, ISO, and other styles

15

Christoffolete, Marcelo A., Rafael Arrojo e Drigo, Fernanda Gazoni, et al. "Mice with Impaired Extrathyroidal Thyroxine to 3,5,3′-Triiodothyronine Conversion Maintain Normal Serum 3,5,3′-Triiodothyronine Concentrations." Endocrinology 148, no. 3 (2007): 954–60. http://dx.doi.org/10.1210/en.2006-1042.

Full text

Abstract:

For T3 to mediate its biological effects, the prohormone T4 must be activated by removal of an outer-ring iodine by the type 1 or 2 deiodinases (D1 and D2) with approximately 60% of the daily T3 production in rodents being produced extrathyroidally through this pathway. To further define the role of these enzymes in thyroid hormone homeostasis, we backcrossed the targeted disruption of the Dio2 gene into C3H/HeJ (C3H) mice with genetically low D1 expression to create the C3H-D2KO mouse. Remarkably, these mice maintain euthyroid serum T3 levels with normal growth and no decrease in expression o

APA, Harvard, Vancouver, ISO, and other styles

16

Joffe, Russell T. "Triiodothyronine Potentiation of Fluoxetine in Depressed Patients*." Canadian Journal of Psychiatry 37, no. 1 (1992): 48–50. http://dx.doi.org/10.1177/070674379203700111.

Full text

Abstract:

Triiodothyronine (T3) has been shown to augment the therapeutic effect of tricyclic antidepressants as well as monoamine oxidase inhibitors. In this report, three cases of T3 potentiation of the antidepressant effect of fluoxetine are described. The results suggest that T3 augmentation may be effective with a wide range of antidepressants.

APA, Harvard, Vancouver, ISO, and other styles

17

Rifqiyah, Nichlah, Hindar Panguji, Irkham Widiyono, and Pudji Astuti. "Profile of Triiodothyronine (T3) and Thyroxine (T4) of female Bali breed cattle transported by traditional vessel from Sumbawa to Pontianak." Digital Press Physical Sciences and Engineering 1 (2018): 00004. http://dx.doi.org/10.29037/digitalpress.11245.

Full text

Abstract:

<p class="Abstract">Transportation of livestock using traditional vessel is one of traditional methodused to fulfill the needs of beef. It requires precise handling because it may cause stress in animals. Transportation stress causing 8 to 11 % of animal death, decreasing the body weight up to 8 % and decreasing reproductive performance of animals. This study aimed to determine the profile of triiodothyronine (T3) and thyroxine (T4) hormones in 1 to 2 y.o female Bali breeding cattle transported from Sumbawa to Pontianak for 120 h using 100 GT traditional vessel with two floors and a capa

APA, Harvard, Vancouver, ISO, and other styles

18

Saltzman, J. R., D. W. Clark, and R. D. Utiger. "Diminished hepatic triiodothyronine production in Gunn rats." Acta Endocrinologica 113, no. 2 (1986): 281–88. http://dx.doi.org/10.1530/acta.0.1130281.

Full text

Abstract:

Abstract. The liver is a major site of conversion of thyroxine (T4) to the more active thyroid hormone 3,5,3'-triiodothyronine (T3). Hepatic T4 to T3 conversion is altered by a variety of pathological processes and pharmacological agents. We studied T4 to T3 conversion in glucuronyl transferase deficient homozygous Gunn rats because they have a hepatic enzyme abnormality which leads to hyperbilirubinaemia, and also because they have been reported to have alterations in thyroid hormone metabolism. An in vitro incubation system employing the 10 000 × g supernatant of liver homogenate was used, a

APA, Harvard, Vancouver, ISO, and other styles

19

SALTER, DAVID R., CORNELIUS M. DYKE, and ANDREW S. WECHSLER. "Triiodothyronine (T3) and Cardiovascular Therapeutics: A Review." Journal of Cardiac Surgery 7, no. 4 (1992): 363–74. http://dx.doi.org/10.1111/j.1540-8191.1992.tb01029.x.

Full text

APA, Harvard, Vancouver, ISO, and other styles

20

Barlow, John W., Andrea J. Curtis, Lorna E. Raggatt, Nicole M. Loidl, Duncan J. Topliss, and Jan R. Stockigt. "Drug competition for intracellular triiodothyronine-binding sites." European Journal of Endocrinology 130, no. 4 (1994): 417–21. http://dx.doi.org/10.1530/eje.0.1300417.

Full text

Abstract:

Barlow JW, Curtis AJ, Raggatt LE, Loidl NM, Topliss DJ. Stockigt JR. Drug competition for intracellular triiodothyronine-binding sites. Eur J Endocrinol 1944;130:417–21. ISSN 0804–4643 A variety of substances, including frusemide, non-esterified fatty acids (NEFAs) and non-steroidal antiinflammatory drugs (NSAIDs), can compete for triiodothyronine (T3)-binding sites in serum and at the cell surface. We examined the competitive potency of these agents at intracellular T3-binding sites in order to assess their potential to act as T3 antagonists. Competition for [125I]T3 binding was determined us

APA, Harvard, Vancouver, ISO, and other styles

21

Witherspoon, L. R., S. E. Shuler, and S. Gilbert. "Estimation of thyroxin, triiodothyronine, thyrotropin, free thyroxin, and triiodothyronine uptake by use of magnetic-particle solid phases." Clinical Chemistry 31, no. 3 (1985): 413–19. http://dx.doi.org/10.1093/clinchem/31.3.413.

Full text

Abstract:

Abstract We evaluated solid-phase radioassays involving small, uniform magnetic particles (MAGIC, Corning Medical), obtaining data on total serum thyroxin (T4), triiodothyronine (T3), thyrotropin (TSH), free thyroxin (FT4), and T3 uptake for a total of 301 serum samples from euthyroid patients; patients receiving replacement thyroxin; patients receiving estrogen, or who were pregnant; hyperthyroid, hypothyroid, and nonthyroidally ill patients; and patients receiving salicylates, phenytoin, or heparin. We found each procedure to be technically simple and precise (between-assay CVs for T4 2.8-8.

APA, Harvard, Vancouver, ISO, and other styles

22

Burch, W. M., and J. J. Van Wyk. "Triiodothyronine stimulates cartilage growth and maturation by different mechanisms." American Journal of Physiology-Endocrinology and Metabolism 252, no. 2 (1987): E176—E182. http://dx.doi.org/10.1152/ajpendo.1987.252.2.e176.

Full text

Abstract:

The mechanisms by which triiodothyronine (T3) stimulates growth and maturation of growth-plate cartilage in vitro were studied by incubating embryonic chick pelvic cartilages in serum-free medium in the presence and absence of T3 for 3 days. To determine whether T3 might stimulate production of somatomedins by the cartilage, medium from cartilage incubated with and without T3 was assayed for somatomedin C (Sm-C) by radioimmunoassay. No difference in Sm-C content was found. However, cartilage incubated with T3 and increasing amounts of human Sm-C (0.5-20 ng/ml) weighed more and had greater amou

APA, Harvard, Vancouver, ISO, and other styles

23

Herviani, I., M. Zairin Junior, and Odang Carman. "Effect of Triiodothyronine in Different Dosages on Growth and Survival Rate of Giant Gouramy (Osphronemus gouramy Lac.)." Jurnal Akuakultur Indonesia 2, no. 2 (2007): 61. http://dx.doi.org/10.19027/jai.2.61-65.

Full text

Abstract:

<p>This experiment was conducted to study the effect of giant gouramy larval immersion in triiodothyronine (T3) hormone solution on their growth and survival rate. One-day old larvae were treated with different concentrations of triiodothyronine (T3) <em>i.e. </em>0; 0,001; 0,01; 0,1 and 1 ppm by immersion method for 24 hours. During eight weeks rearing period, larvae were fed to satiation with <em>Tubifex </em>three times daily. The media were aerated and changed 10-30% daily. At the end of experiment, there was no significant difference in yolk sac absorption be

APA, Harvard, Vancouver, ISO, and other styles

24

de Escobar, Gabriella Morreale, María Jesís Obregón, Carmen Ruiz de Oña, and Francisco Escobar del Rey. "Comparison of maternal to fetal transfer of 3,5,3 ′-triiodothyronine versus thyroxine in rats, as assessed from 3,5,3′-triiodothyronine levels in fetal tissues." Acta Endocrinologica 120, no. 1 (1989): 20–30. http://dx.doi.org/10.1530/acta.0.1200020.

Full text

Abstract:

Abstract. Thyroxine (T4) is transferred from the mother to the hypothyroid rat fetus late in gestation, mitigating T4 and T3 deficiency in fetal tissues, the brain included. We have now compared the effects of maternal infusion with T3. Normal and thyroidectomized rats were started on methimazole (MMI) on the 14th day of gestation, given alone, or together with a constant infusion of 0.45 μg (0.69 nmol) T3 or of 1.8 μg (2.3 nmol) T4/100 g per day. Maternal and fetal samples were obtained at the 21st day of gestation. The doses of T3 and T4 were biologically equivalent for the dams, as assessed

APA, Harvard, Vancouver, ISO, and other styles

25

Hershman, Jerome M., Koonlawee Nademanee, Masahiro Sugawara, et al. "Thyroxine and triiodothyronine kinetics in cardiac patients taking amiodarone." Acta Endocrinologica 111, no. 2 (1986): 193–99. http://dx.doi.org/10.1530/acta.0.1110193.

Full text

Abstract:

Abstract. Cardiac patients taking amiodarone, a potent anti-arrhythmic drug, often have supranormal serum thyroxine (T4) levels and normal or mildly reduced serum triiodothyronine (T3) levels. We studied T4 and T3 kinetics and conversion of T4 to T3 in 5 men with recurrent paroxysmal tachycardia before and after 5–6 weeks of therapy with amiodarone (dose 200–800 mg/day). The patients were also receiving various medicines for cardiac disease. Each was injected with tracer doses of labelled T4 and T3; serum samples were processed by TCA precipitation and ethanol extraction. The data were analyze

APA, Harvard, Vancouver, ISO, and other styles

26

Kumar, Rajeev Ranjan, and Jyoti Prakash. "Plasma Thyroid Hormone Concentration is Associated with Hepatic Triglyceride Content in Patients with Type 2 Diabetes." International Journal of Medical and Biomedical Studies 8, no. 3 (2024): 224–27. http://dx.doi.org/10.32553/ijmbs.v8i3.2849.

Full text

Abstract:

This cross-sectional study investigated the association between plasma thyroid hormone levels and hepatic triglyceride content in 150 patients with type 2 diabetes. Our findings revealed a significant negative correlation between plasma triiodothyronine (T3) levels and hepatic triglyceride content, suggesting a protective metabolic role of T3. No significant correlations were observed with thyroxine (T4) or thyroid-stimulating hormone (TSH). The study underscores the potential of T3 as a modulator of hepatic lipid metabolism in diabetic patients, highlighting its relevance in managing hepatic

APA, Harvard, Vancouver, ISO, and other styles

27

Desai, R. K., B. Bredenkamp, I. Jialal, M. A. Omar, M. C. Rajput, and S. M. Joubert. "Autoantibodies to thyroxin and triiodothyronine." Clinical Chemistry 34, no. 5 (1988): 944–46. http://dx.doi.org/10.1093/clinchem/34.5.944.

Full text

Abstract:

Abstract Two clinically euthyroid patients with multinodular goiter were found to have high "free" thyroxin (Amerlex-M, Amersham and Coat-a-Count, DPC) and triiodothyronine (Amerlex-M) concentrations (FT4 and FT3, respectively). The presence of antibodies to T4 and T3 was confirmed by the finding that polyethylene glycol precipitated a far greater proportion of radioactivity when radiolabeled FT4 or FT3 analog (Amerlex-M) was incubated with serum from these patients than was true for normal subjects. With this method we could not demonstrate antibodies to thyroid hormones in 116 healthy volunt

APA, Harvard, Vancouver, ISO, and other styles

28

Rodriguez, M., and T. Jolin. "Triiodothyronine receptor complex in developing rat brain and pituitary." American Journal of Physiology-Endocrinology and Metabolism 264, no. 5 (1993): E804—E809. http://dx.doi.org/10.1152/ajpendo.1993.264.5.e804.

Full text

Abstract:

In vitro saturation analysis combined with nuclear 3,5,3'-triiodothyronine (T3) quantification was used to examine the changes in T3 binding parameters in rat pituitary and cerebrocortical nuclei from fetal day 14 to postnatal day 20. T3 receptors were first detectable in neuronal, glial, and pituitary nuclei on fetal days 14, 17, and 18, respectively. Thereafter T3 receptor concentrations in neuronal, glial, and pituitary nuclei increased throughout the developmental period studied, reaching maximal levels during neonatal life (1,129, 1,025, and 635 fmol/mg DNA, respectively). T3 levels in pi

APA, Harvard, Vancouver, ISO, and other styles

29

Nakamura, Hirotoshi, Toshihiko Yokota, and Hiroo Imura. "Different alterations of nuclear triiodothyronine receptor capacity in liver and kidney induced by starvation and triiodothyronine administration." Acta Endocrinologica 108, no. 2 (1985): 206–10. http://dx.doi.org/10.1530/acta.0.1080206.

Full text

Abstract:

Abstract. Many studies have shown alterations in the number of nuclear triiodothyronine receptor (NT3R) under pathophysiologic situations. Most of these studies were performed on the rat liver and it is not known whether NT3R in different tissues exhibits an alteration similar to that in the liver. We compared the change of nuclear receptor capacity for T3 in the liver and kidney during starvation and after T3 injection. Fasting for 72 h decreased maximal binding capacity (Cmax) in the rat liver receptor to 67% of the control, while it did not significantly change Cmax in the kidney. These cha

APA, Harvard, Vancouver, ISO, and other styles

30

Napoli, Raffaele, Vincenzo Guardasole, Valentina Angelini, et al. "Acute Effects of Triiodothyronine on Endothelial Function in Human Subjects." Journal of Clinical Endocrinology & Metabolism 92, no. 1 (2007): 250–54. http://dx.doi.org/10.1210/jc.2006-1552.

Full text

Abstract:

Abstract Context: Thyroid hormone regulates several cardiovascular functions, and low T3 levels are frequently associated with cardiovascular diseases. Whether T3 exerts any acute and direct effect on endothelial function in humans is unknown. Objective: Our objective was to clarify whether acute changes in serum T3 concentration affect endothelial function. Design, Setting, and Subjects: Ten healthy subjects (age, 24 ± 1 yr) participated in a double-blind, placebo-controlled trial at a university hospital. Interventions: T3 (or placebo) was infused for 7 h into the brachial artery to raise lo

APA, Harvard, Vancouver, ISO, and other styles

31

LoPresti, J. S. "3,5,3'-Triiodothyronine (T3) sulfate: a major metabolite in T3 metabolism in man." Journal of Clinical Endocrinology & Metabolism 78, no. 3 (1994): 688–92. http://dx.doi.org/10.1210/jc.78.3.688.

Full text

APA, Harvard, Vancouver, ISO, and other styles

32

LoPresti, J. S., and J. T. Nicoloff. "3,5,3'-Triiodothyronine (T3) sulfate: a major metabolite in T3 metabolism in man." Journal of Clinical Endocrinology & Metabolism 78, no. 3 (1994): 688–92. http://dx.doi.org/10.1210/jcem.78.3.8126143.

Full text

APA, Harvard, Vancouver, ISO, and other styles

33

du Pont, John S. "Triiodothyronine affects the electrical properties of GH3 cells." Acta Endocrinologica 123, no. 1 (1990): 51–60. http://dx.doi.org/10.1530/acta.0.1230051.

Full text

Abstract:

Abstract. Electrophysiological experiments show that T3 has a direct effect on the cell membrane of GH3 cells, a transformed line from the rat pituitary. Slope conductance versus membrane potential, resting membrane resistance, potential, capacity and action potentials were measured in this study. Using a current clamp technique, the effects of tetrodotoxin, tetraethylammonium, apamin, and nifedipine were measured and compared with those directly evoked by T3. T3 increased the slope conductance: 1. at around −60 mV, as did tetrodotoxin (Na+ channel blocker); 2. at about −40 mV, as did nifedipi

APA, Harvard, Vancouver, ISO, and other styles

34

Barnett, M. C., J. P. Goopy, J. R. McFarlane, I. R. Godwin, J. V. Nolan, and R. S. Hegarty. "Triiodothyronine influences digesta kinetics and methane yield in sheep." Animal Production Science 52, no. 7 (2012): 572. http://dx.doi.org/10.1071/an11303.

Full text

Abstract:

Methane yield from ruminants is positively correlated with mean retention time (MRT) of digesta, which is known to be influenced by the hormone triiodothyronine (T3).We hypothesised that a decrease in the MRT in the rumen in response to administration of a T3 solution to sheep would reduce their methane yield. To test this hypothesis, 10 mature Merino wethers were injected with T3 (300 µg) on two different protocols (daily; n = 5 and every second day; n = 5) and the effect on daily methane yield, digesta MRT, DM digestibility, rumen volatile fatty acid concentrations, microbial protein output

APA, Harvard, Vancouver, ISO, and other styles

35

Irwin, R. S., M. R. Pratter, D. H. Stivers, and L. E. Braverman. "Airway reactivity and lung function in triiodothyronine-induced thyrotoxicosis." Journal of Applied Physiology 58, no. 5 (1985): 1485–88. http://dx.doi.org/10.1152/jappl.1985.58.5.1485.

Full text

Abstract:

To evaluate the possible relationship between asthma and hyperthyroidism, airway reactivity and lung function were prospectively compared in healthy volunteers before, during, and after liothyronine (triiodothyronine, T3)-induced hyperthyroidism. Base-line evaluation of the 10 subjects included clinical evaluation, thyroid and pulmonary function tests, and airway reactivity assessed by methacholine inhalational challenge (MIC). All studies were normal. During T3-induced hyperthyroidism, no subject developed respiratory symptoms or changes in pulmonary function or airway reactivity. The mean pe

APA, Harvard, Vancouver, ISO, and other styles

36

Rosebrough. "Dietary Fat and Triiodothyronine (T3) Interactions in the Broiler Chicken." International Journal for Vitamin and Nutrition Research 69, no. 4 (1999): 292–98. http://dx.doi.org/10.1024/0300-9831.69.4.292.

Full text

Abstract:

Male, Indian River, broiler chickens growing from 7 to 28 d were fed on diets containing 180 g crude protein, 300, 600 or 1200 kcal fat calories and 0 or 1 mg T3/kg diet. Birds were bled and sacrificed at d 28, 29 and 30. Measurements taken at these intervals included in vitro lipogenesis (IVL), growth and feed consumption and hepatic enzyme activities. Plasma metabolites as well as thyroid hormones were also determined. Dietary fat levels did not influence growth or feed intake. In contrast, T3 decreased growth and feed intake by 25% without altering the efficiency of feed utilization. Dietar

APA, Harvard, Vancouver, ISO, and other styles

37

Liqhtner, E. S., J. Magner, P. Petrick, and B. Weintraub. "66 INAPPROPRIATE TSH SYNDROME (ITSHS)-TRIIODOTHYRONINE (T3) THERAPY." Pediatric Research 19, no. 6 (1985): 614. http://dx.doi.org/10.1203/00006450-198506000-00086.

Full text

APA, Harvard, Vancouver, ISO, and other styles

38

Wang, Ruiyao, Feng Gao, Chunji Niu, et al. "Interactions between rare earths and 3,5,3′-triiodothyronine (T3)." Chinese Science Bulletin 42, no. 17 (1997): 1444–47. http://dx.doi.org/10.1007/bf02883055.

Full text

APA, Harvard, Vancouver, ISO, and other styles

39

Weisiger, R. A., B. A. Luxon, and R. R. Cavalieri. "Hepatic uptake of 3,5,3'-triiodothyronine: electrochemical driving forces." American Journal of Physiology-Gastrointestinal and Liver Physiology 262, no. 6 (1992): G1104—G1112. http://dx.doi.org/10.1152/ajpgi.1992.262.6.g1104.

Full text

Abstract:

We used the multiple indicator dilution technique to assess the electrochemical forces driving uptake of 3,5,3'-triiodo-L-thyronine (T3) across the basolateral plasma membrane in the single-pass perfused rat liver. With the use of 4 g/dl albumin solutions, the influx and efflux clearances were 0.020 +/- 0.005 and 0.0049 +/- 0.0017 (SE) ml.s-1.g liver-1, respectively, indicating that the total T3 concentration at equilibrium should be about four times greater in cytoplasm than in plasma. However, when the influx and efflux clearances were divided by the unbound (free) T3 concentration in the pe

APA, Harvard, Vancouver, ISO, and other styles

40

Eiler, Hugo, and Cindy S. Armstrong-Backus. "Passage of exogenous L-thyroxine and triiodothyronine into bovine ejaculate." American Journal of Veterinary Research 48, no. 3 (1987): 439–43. https://doi.org/10.2460/ajvr.1987.48.03.439.

Full text

Abstract:

SUMMARY The metabolic effects of thyroxine (T4) and triiodothyronine (T3) on spermatozoa metabolism and male anatomy have been demonstrated. The metabolic effects of T3 and T4 could affect the physiologic characteristics of the spermatozoa. There are little data on the passage of T4 and T3 into the ejaculate from blood. The passage of exogenous T4 and T3 from the blood into semen was measured after T4 (45 mg) or T3 (37.5 mg) was injected iv into 8 bulls. Blood and electroejaculate were obtained simultaneously at 20, 40, 60, 120, and 180 minutes and 24 hours after bulls were injected to determi

APA, Harvard, Vancouver, ISO, and other styles

41

Lewis, D. S., E. M. Jackson, and G. E. Mott. "Triiodothyronine accelerates maturation of bile acid metabolism in infant baboons." American Journal of Physiology-Endocrinology and Metabolism 268, no. 5 (1995): E889—E896. http://dx.doi.org/10.1152/ajpendo.1995.268.5.e889.

Full text

Abstract:

We tested the hypothesis that triiodothyronine (T3) treatment accelerates the early postnatal maturation of bile acid metabolism in the baboon. Infant baboons were implanted with 21-day-release pellets containing T3 (n = 12), a placebo pellet (n = 6), or no pellet (n = 13). T3 treatment increased plasma T3 concentrations from 3.0 to 5.0 nmol/l between birth and 15 wk of age. At 15 wk of age, bile acid pool sizes, fractional turnover rates (FTR), and synthetic rates were determined by an isotope-dilution method with 3H- and 14C-labeled cholic (CA) and chenodeoxycholic acid (CDCA). T3 treatment

APA, Harvard, Vancouver, ISO, and other styles

42

Gaschen, F., J. Thompson, K. Beale, and K. Keisling. "Recognition of triiodothyronine-containing epitopes in canine thyreoglobulin by circulating thyroglobulin autoantibodies." American Journal of Veterinary Research 54, no. 2 (1993): 244–47. http://dx.doi.org/10.2460/ajvr.1993.54.02.244.

Full text

Abstract:

SUMMARY Serum triiodothyronine autoantibody (T3 AA), triiodothyronine (T3), and thyroxine (T4) concentrations were determined in 45 canine sera containing substantial amounts of thyroglobulin autoantibodies (Tg AA); sera also were assayed to investigate the ability of free T3 to inhibit Tg AA binding to canine Tg, Serum T3 AA concentrations defined 2 groups of sera; 28 sera had low T3 AA concentration (≤ 20 ng/ ml) and 17 sera had high T3 aa concentration (≥ 250 ng/ml). Direct linear correlation between T3 AA concentration and apparent serum T3 concentration was observed (r = 0.75). Serum with

APA, Harvard, Vancouver, ISO, and other styles

43

Citterio, Cintia E., Berenice Morales-Rodriguez, Xiao-Hui Liao, et al. "A Genetically-Engineered Thyroid Gland Built for Selective Triiodothyronine Secretion." International Journal of Molecular Sciences 26, no. 15 (2025): 7166. https://doi.org/10.3390/ijms26157166.

Full text

Abstract:

Thyroid hormones (thyroxine, T4, and triiodothyronine, T3) are indispensable for sustaining vertebrate life, and their deficiency gives rise to a wide range of symptoms characteristic of hypothyroidism, affecting 5–10% of the world’s population. The precursor for thyroid hormone synthesis is thyroglobulin (Tg), a large iodoglycoprotein consisting of upstream regions I-II-III (responsible for synthesis of most T4) and the C-terminal CholinEsterase-Like (ChEL) domain (responsible for synthesis of most T3, which can also be generated extrathyroidally by T4 deiodination). Using CRISPR/Cas9-mediate

APA, Harvard, Vancouver, ISO, and other styles

44

Khdayer Tuma Rotha. "Study the changing that happen in the concentration of thyroid hormones values in healthy persons of Wasit Province." Journal of Wasit for Science and Medicine 8, no. 3 (2022): 137–42. http://dx.doi.org/10.31185/jwsm.280.

Full text

Abstract:

The principal hormones of thyroid gland are thyroxine (T4) and triiodothyronine (T3). The current study was carried out to investigate the effect of age, gender of Thyroxine (T4), Triiodothyronine (T3) and Thyroid Stimulating Hormone (TSH) in normal healthy individuals were measure in healthy subject. Methods: Serum levels of T4, T3 and TSH in 534 normal healthy individuals belonging to different districts to Wasit Province, of deferent parts to the city center alkarama and al Zahra AL-Hai AL-Aziziya AL-Nomania Wasit, Iraq, were examined. Serum T4 , T3 and TSH were analyzed by enzyme linked im

APA, Harvard, Vancouver, ISO, and other styles

45

Hollingsworth, H. M., M. R. Pratter, J. M. Dubois, L. E. Braverman, and R. S. Irwin. "Effect of triiodothyronine-induced thyrotoxicosis on airway hyperresponsiveness." Journal of Applied Physiology 71, no. 2 (1991): 438–44. http://dx.doi.org/10.1152/jappl.1991.71.2.438.

Full text

Abstract:

To determine whether thyrotoxicosis has an effect on the asthmatic state in subjects with mild asthma, airway responsiveness, lung function, and exercise capacity were measured in a randomized double-blind placebo-controlled trial before and after liothyronine (triiodothyronine, T3)-induced thyrotoxicosis. Baseline evaluation of 15 subjects with mild asthma included clinical evaluation, thyroid and routine pulmonary function tests, airway responsiveness assessment by methacholine inhalation challenge, and a symptom-limited maximal exercise test. For all subjects, the initial testing revealed t

APA, Harvard, Vancouver, ISO, and other styles

46

Chapital, Alyssa D., Steven R. Hendrick, Larry Lloyd, and David Pieper. "The Effects of Triiodothyronine Augmentation on Antithrombin III Levels in Sepsis." American Surgeon 67, no. 3 (2001): 253–56. http://dx.doi.org/10.1177/000313480106700310.

Full text

Abstract:

Sepsis and multisystem organ failure are often associated with disseminated intravascular coagulation and consumption of coagulation inhibitors such as antithrombin III (ATIII). The “sick euthyroid syndrome” is also seen in association with significant illnesses and consists of decreased levels of circulating triiodothyronine (T3). We evaluated whether T3 supplementation would affect ATIII levels in septic rats. Thirty Sprague-Dawley rats were divided into three groups: sham laparotomy (S) plus saline, cecal ligation and puncture (CLP) plus saline, and CLP plus T3 (3 ng/hour) via an osmotic mi

APA, Harvard, Vancouver, ISO, and other styles

47

Mazumder, Anjana, Kamal Das, and Pranab K. Sarkar. "Regulation of tubulin by triiodothyronine in hypothyroid rat brain." Bioscience Reports 5, no. 8 (1985): 643–48. http://dx.doi.org/10.1007/bf01116995.

Full text

Abstract:

The effect of T3 (triiodothyronine) on the induction of tubulin in hypothyroid developing rat brain has been examined using organ cultures of brains from late fetal, neonatal and postnatalrats. The neonatal brain displayed maximum sensitivity to T3. Hypothyroidism resulted in a 26% decline in the level of tubulin in the neonatal brain as opposed to a 5–15% decline in the fetal or postnatal brain. Exposure of the hypothyroi d neonatal brain to T3 for 2 h in culture led to a 61% rise in the level of tubulin in contrast to a 41% increase seen in the case of normal brain. Total protein synthesis w

APA, Harvard, Vancouver, ISO, and other styles

48

Wrutniak, Chantal, Gérard Cabello, and Michel Bosc. "Plasma free and total iodothyronine levels in hypophysectomized and intact lamb foetuses during the last third of gestation." Acta Endocrinologica 110, no. 3 (1985): 388–94. http://dx.doi.org/10.1530/acta.0.1100388.

Full text

Abstract:

Abstract. The changes in plasma levels of thyroxine (T4), free thyroxine (free T4), triiodothyronine (T3), free triiodothyronine (free T3), and reverse triiodothyronine (rT3) were observed in intact or hypophysectomized lamb foetuses during the last third of gestation. Hypophysectomy was performed at two stages: 100 and 120 days of gestation. Cord blood was collected after Caesarean section. In intact foetuses, T4 and free T4 levels increased significantly between day 100 and 120 of gestation, but decreased from day 132 to birth. T3 levels, low until day 132, rose abruptly during the last 12 d

APA, Harvard, Vancouver, ISO, and other styles

49

Pereira, Renata C., Vanda Jorgetti, and Ernesto Canalis. "Triiodothyronine induces collagenase-3 and gelatinase B expression in murine osteoblasts." American Journal of Physiology-Endocrinology and Metabolism 277, no. 3 (1999): E496—E504. http://dx.doi.org/10.1152/ajpendo.1999.277.3.e496.

Full text

Abstract:

Triiodothyronine (T3) increases bone resorption, but its effects on matrix metalloprotease (MMP) expression in bone are unknown. We tested the effects of T3 on collagenase-3 and gelatinase A and B expression in MC3T3 osteoblastic cells. T3 at 1 nM to 1 μM for 24–72 h increased collagenase-3 and gelatinase B mRNA levels, but it did not increase gelatinase A transcripts. In addition, T3 increased immunoreactive collagenase and gelatinase activity. Cycloheximide prevented the stimulatory effect of T3 on collagenase-3 but not on gelatinase B transcripts. Indomethacin did not prevent the effect of

APA, Harvard, Vancouver, ISO, and other styles

50

Reed, H. L., M. M. D'Alesandro, K. R. Kowalski, and L. D. Homer. "Multiple cold air exposures change oral triiodothyronine kinetics in normal men." American Journal of Physiology-Endocrinology and Metabolism 263, no. 1 (1992): E85—E93. http://dx.doi.org/10.1152/ajpendo.1992.263.1.e85.

Full text

Abstract:

The influence of cold exposure on triiodothyronine (T3) kinetics was studied in 16 men before, during (biweekly), and after 80 (10/wk) cold (4 degrees C) air exposures. We used serum values before and up to 24 h after a pharmacological oral (o) dose of T3 [76.8 nmol (50 micrograms)] to calculate noncompartmental kinetic parameters. To assess the role of thyroxine (T4) and thyrotropin (TSH), we administered a replacement dose of T3 [46.0 nmol/day (30 micrograms)] to eight men (+T3 group) and placebo to eight others (-T3 group) for the 2-mo study. There was no group effect of T3 treatment (+T3)

APA, Harvard, Vancouver, ISO, and other styles

We offer discounts on all premium plans for authors whose works are included in thematic literature selections. Contact us to get a unique promo code!