Academic literature on the topic 'T3 (Triiodothyronine)'

Create a spot-on reference in APA, MLA, Chicago, Harvard, and other styles

Select a source type:

Consult the lists of relevant articles, books, theses, conference reports, and other scholarly sources on the topic 'T3 (Triiodothyronine).'

Next to every source in the list of references, there is an 'Add to bibliography' button. Press on it, and we will generate automatically the bibliographic reference to the chosen work in the citation style you need: APA, MLA, Harvard, Chicago, Vancouver, etc.

You can also download the full text of the academic publication as pdf and read online its abstract whenever available in the metadata.

Journal articles on the topic "T3 (Triiodothyronine)"

1

Peterson, Mark E., Thomas K. Graves, and David A. Gamble. "Triiodothyronine (T3) Suppression Test." Journal of Veterinary Internal Medicine 4, no. 5 (1990): 233–38. http://dx.doi.org/10.1111/j.1939-1676.1990.tb03114.x.

Full text
APA, Harvard, Vancouver, ISO, and other styles
2

Young, Diane W., James L. Sartin, and Robert J. Kemppainen. "Abnormal canine triiodothyronine-binding factor characterized as a possible triiodothyronine autoantibody." American Journal of Veterinary Research 46, no. 6 (1985): 1346–50. https://doi.org/10.2460/ajvr.1985.46.06.1346.

Full text
Abstract:
SUMMARY Of more than 6,000 canine serum samples submitted to the Endocrine Diagnostic Laboratory of the School of Veterinary Medicine, Auburn University, Ala, for thyroid evaluation in 1983, 18 contained an abnormal triiodothyronine (T3)-binding factor (T3BF). These samples were easily distinguished from non-T3BF containing samples because the factor interfered with the radioimmunoassay for total T3 resulting in a profound increase in apparent values for T3 concentration. Most of the T3BF-containing samples did not have unusual thyroxine binding or inappropriate thyroxine concentrations.Triiod
APA, Harvard, Vancouver, ISO, and other styles
3

Sapin, Rémy. "Triiodothyronine (T3) totale et libre." EMC - Biologie Médicale 1, no. 1 (2006): 1–6. http://dx.doi.org/10.1016/s2211-9698(06)76132-5.

Full text
APA, Harvard, Vancouver, ISO, and other styles
4

Troshina, E. A., and E. S. Senyushkina. "Metabolic Systemic Effects Triiodothyronine." Russian Archives of Internal Medicine 10, no. 4 (2020): 262–71. http://dx.doi.org/10.20514/2226-6704-2020-10-4-262-271.

Full text
Abstract:
Triiodothyronine (T3, 3,5,3’-L-triiodothyronine) is a thyroid hormone (thyroid), the secretion of which is carried out directly both by the gland (to a lesser extent) and outside it (the main amount; as a result of peripheral deiodination of thyroxine (T4)). Getting into the nuclei of cells, T3 interacts with specific nuclear receptors of target tissues, which determines its biological activity. This interaction leads to the activation of transcription of a number of genes.In the pituitary gland and peripheral tissues, the action of thyroid hormones is modulated by local deiodinases, which con
APA, Harvard, Vancouver, ISO, and other styles
5

Fan, Lu, Athanasia Warnecke, Julia Weder, Matthias Preller, and Carsten Zeilinger. "Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site." International Journal of Molecular Sciences 23, no. 13 (2022): 7150. http://dx.doi.org/10.3390/ijms23137150.

Full text
Abstract:
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
APA, Harvard, Vancouver, ISO, and other styles
6

Tan, Theresa M. C., and Kim Ping Wong. "Hepatic sulphate conjugation of triiodothyronine (T3)." Biochemical Pharmacology 37, no. 14 (1988): 2859–62. http://dx.doi.org/10.1016/0006-2952(88)90051-2.

Full text
APA, Harvard, Vancouver, ISO, and other styles
7

Lowe, John C., Richard L. Garrison, Alan Reichman, and Jackie Yellin. "Triiodothyronine (T3) Treatment of Euthyroid Fibromyalgia." Clinical Bulletin of Myofascial Therapy 2, no. 4 (1997): 71–88. http://dx.doi.org/10.1300/j425v02n04_05.

Full text
APA, Harvard, Vancouver, ISO, and other styles
8

Katzeff, H. L., D. Bovbjerg, and D. A. Mark. "Exercise regulation of triiodothyronine metabolism." American Journal of Physiology-Endocrinology and Metabolism 255, no. 6 (1988): E824—E828. http://dx.doi.org/10.1152/ajpendo.1988.255.6.e824.

Full text
Abstract:
Negative caloric balance reduces triiodothyronine (T3) production in both humans and rodents. The effects of chronic voluntary exercise and various levels of caloric intake and balance on T3 metabolism were studied in adult male C57/BL6 mice to determine if exercise had any direct effects on T3 production in vivo and in vitro. Chronic voluntary exercise was induced by the addition of running wheels to cages for 28 days. Ad libitum-fed exercising mice ingested 20% greater calories (P less than 0.02), maintained body weight, and increased T3 production (53.1 +/- 5.3 vs. 42.3 +/- 3.4 ng.h-1.100 m
APA, Harvard, Vancouver, ISO, and other styles
9

Isozaki, Osamu, Toshio Tsushima, Kanji Sato, et al. "Triiodothyronine binding immunoglobulin in a euthyroid man without apparent thyroid disease; its properties and effects on triiodothyronine metabolism." Acta Endocrinologica 108, no. 4 (1985): 498–503. http://dx.doi.org/10.1530/acta.0.1080498.

Full text
Abstract:
Abstract. A 54 year old man with markedly elevated serum T3, but without an apparent thyroid disease, was found to have a specific antibody to T3. His serum thyroxine, TBG and TSH were in normal range, but T3-RSU was markedly low. Antibodies to thyroglobulin and microsome were negative. He was judged euthyroid because of a normal basal metabolic rate and a normal thyroidal 123I uptake which was suppressed by T3 adminnistration. When serum was extracted with ethanol prior to assay, serum T3 was found to be in the upper border of normal range. Several experiments revealed the presence of an anti
APA, Harvard, Vancouver, ISO, and other styles
10

Karapitta, Christina D., Theodore G. Sotiroudis, Athanassios Papadimitriou, and Aristotelis Xenakis. "Homogeneous Enzyme Immunoassay for Triiodothyronine in Serum." Clinical Chemistry 47, no. 3 (2001): 569–74. http://dx.doi.org/10.1093/clinchem/47.3.569.

Full text
Abstract:
Abstract Background: The concentration of triiodothyronine (T3) in human serum is extremely low and can be determined only by very sensitive methods. We developed a homogeneous enzyme immunoassay for T3 analysis in unextracted serum. Methods: A T3 derivative was conjugated to the −SH groups of glycogen phosphorylase b (GPb) from rabbit muscle. Conjugation caused inhibition of enzyme activity, and the enzyme conjugate was reactivated upon binding of anti-T3 antibody. Activation was blocked by the presence of non-antibody-bound T3; this was the basis for the development of the homogeneous enzyme
APA, Harvard, Vancouver, ISO, and other styles
More sources

Dissertations / Theses on the topic "T3 (Triiodothyronine)"

1

PULIGA, ELISABETTA. "POTENTIAL THERAPEUTIC USE OF TRIIODOTHYRONINE (T3) IN HEPATOCELLULAR CARCINOMA." Doctoral thesis, Università degli Studi di Cagliari, 2018. http://hdl.handle.net/11584/255968.

Full text
Abstract:
Hepatocellular carcinoma (HCC) is the most common primary malignancy of the liver with a poor prognostic outcome due to limited and ineffective therapeutic strategies. Thus, it is mandatory to develop more efficient and powerful treatments for this aggressive tumor. Recent studies have suggested the possible role of local hypothyroidism in HCC development, in both humans and rodents. Previous observations from our laboratory showed that 1-week exogenous administration of triiodothyronine (T3) induced the regression of preneoplastic hepatic nodules generated by the Resistant Hepatocyte (RH) mod
APA, Harvard, Vancouver, ISO, and other styles
2

Boertje, Ethan Thomas. "Testosterone (T) and Triiodothyronine (T3) in Franklin’s Gull (Leucophaeus Pipixcan) Eggs." Thesis, North Dakota State University, 2018. https://hdl.handle.net/10365/28720.

Full text
Abstract:
Maternally-derived hormones are known to influence the growth and development of offspring. The differential deposition of these maternally-derived hormones into egg yolk is one way by which females can alter and impact their chicks’ survival. Yolk constituents, especially testosterone, have been described for a wide variety of species. However, few studies have focused on multiple maternally-derived hormones regulated by independent axis in the endocrine system, these of which have mainly focused on corticosterone and testosterone. We determined within and among female variation in testostero
APA, Harvard, Vancouver, ISO, and other styles
3

Boertje, Ethan Thomas. "Testosterone (T) and Triiodothyronine (T3) in Franklin?s Gull (Leucophaeus Pipixcan) Eggs." Thesis, North Dakota State University, 2018. https://hdl.handle.net/10365/28720.

Full text
Abstract:
Maternally-derived hormones are known to influence the growth and development of offspring. The differential deposition of these maternally-derived hormones into egg yolk is one way by which females can alter and impact their chicks? survival. Yolk constituents, especially testosterone, have been described for a wide variety of species. However, few studies have focused on multiple maternally-derived hormones regulated by independent axis in the endocrine system, these of which have mainly focused on corticosterone and testosterone. We determined within and among female variation in testostero
APA, Harvard, Vancouver, ISO, and other styles
4

LOZANO, FREDERIC. "Fonction thyroidienne et depression : revue de la litterature, syndrome de basse t3 a propos d'une etude chez 54 patients." Besançon, 1994. http://www.theses.fr/1994BESA3108.

Full text
APA, Harvard, Vancouver, ISO, and other styles
5

Gražienė, Aleksandra. "Padidėjusio laisvo trijodtironino poveikio ypatumai, esant normaliai tirotropinio hormono ir laisvo tiroksino koncentracijai." Doctoral thesis, Lithuanian Academic Libraries Network (LABT), 2012. http://vddb.laba.lt/obj/LT-eLABa-0001:E.02~2012~D_20120918_151340-85920.

Full text
Abstract:
Įtariant skydliaukės patologiją rekomenduojama tirti tirotropinio hormono ir laisvo tiroksino koncentracijas kraujo serume. Laisvo trijodtironino tyrimas nėra įprastinis ir atliekamas kai nustatoma sumažėjusi tirotropinio hormono ir normali laisvo tiroksino koncentracija. Šio darbo tikslas - įvertinti padidėjusio laisvo trijodtironino poveikio ypatumus, esant normaliai tirotropinio hormono ir laisvo tiroksino koncentracijai. Uždaviniai – nustatyti ir įvertinti klinikinių simptomų ypatumus, objektyvaus tyrimo duomenis (odos būklę, skydliaukės padidėjimo laipsnį, širdies ir kraujagyslių sistemos
APA, Harvard, Vancouver, ISO, and other styles
6

Rodier, Anne. "Etude de l'expression et de la localisation de la protéine BTG1 dans les myoblastes aviaires. Régulation par la T3 et implication dans la myogénèse." Montpellier 1, 1999. http://www.theses.fr/1999MON1T011.

Full text
APA, Harvard, Vancouver, ISO, and other styles
7

Marchal, Sophie. "Influence de la triiodothyronine (T3) sur la différenciation des myoblastes aviaires ; implications de la voie AMPc ; mécanismes d'action." Montpellier 1, 1995. http://www.theses.fr/1995MON1T034.

Full text
APA, Harvard, Vancouver, ISO, and other styles
8

Moor, Andrea Nichole. "The in vivo and in vitro effects of 3,5,3'-triiodothyronine (T3) on control and mdx muscle cell proliferation." Thesis, National Library of Canada = Bibliothèque nationale du Canada, 1997. http://www.collectionscanada.ca/obj/s4/f2/dsk3/ftp04/nq23641.pdf.

Full text
APA, Harvard, Vancouver, ISO, and other styles
9

BURY, FABIENNE. "Modulation in vitro de l'expression de la proteine basique encephalitogene de la myeline par la l-3, 5, 3 - triiodothyronine (t3) et distribution des isoformes du recepteur de t3 dans l'encephale du mutant dysmyelinique jimpy." Université Louis Pasteur (Strasbourg) (1971-2008), 1999. http://www.theses.fr/1999STR13236.

Full text
Abstract:
L'objectif de ce travail etait de determiner l'action de la triidothyronine (t3) sur les proteines basiques (mbp) des oligodendrocytes (ol) responsables de la formation des gaines de myeline du systeme nerveux central (snc), lorsque ces cellules sont cultivees en presence de neurones ou d'astrocytes. Le mode d'action de t3 passe par une interaction avec des recepteurs nucleaires specifiques. Trois sont fonctionnels (rt31, rt31, rt32) et rt32 qui ne fixe pas t3 est un antagoniste des rt3 1 et. Leur expression distincte au cours de l'ontogenese du snc suggere des fonctions specifiques et donc la
APA, Harvard, Vancouver, ISO, and other styles
10

Busson, Muriel. "Etude de l'implication de la protéine antiproliférative BTG1 dans la régulation de la différenciation des myoblastes aviaires par la T3." Montpellier, ENSA, 2004. http://www.theses.fr/2004ENSA0010.

Full text
Abstract:
Le gène BTG1 a été identifié lors du clonage d’un point de translocation chromosomique dans un cas de leucémie lymphocytaire chronique des cellules B. Son produit appartient à une famille de protéines antiprolifératives. Les travaux de notre équipe ont établi que la T3 induit indirectement l’expression de ses transcrits à confluence cellulaire et stimule son import nucléaire dans les myoblastes aviaires. En outre, BTG1 reproduit les effets myogéniques de la T3 : stimulation de la sortie des myoblastes du cycle cellulaire et de leur différenciation terminale. Dans ce travail, nous avons étudié
APA, Harvard, Vancouver, ISO, and other styles
More sources

Book chapters on the topic "T3 (Triiodothyronine)"

1

Denardin, O. V. P., R. M. B. Maciel, E. Menabo, E. M. K. Russo, and D. R. Borges. "Impaired Release of Hepatic Triiodothyronine (T3) in the Diabetic Low T3 Syndrome." In Frontiers in Thyroidology. Springer US, 1986. http://dx.doi.org/10.1007/978-1-4684-5260-0_75.

Full text
APA, Harvard, Vancouver, ISO, and other styles
2

Kennedy, Sandra J., and Huw B. Jones. "Renal Pathology of Orally Administered L-Triiodothyronine (T3) in the Rat." In Nephrotoxicity. Springer US, 1989. http://dx.doi.org/10.1007/978-1-4757-2040-2_94.

Full text
APA, Harvard, Vancouver, ISO, and other styles
3

Aguilar, Ricardo A., Louis Ehwerhemuepha, and Terence Sanger. "Investigating the Need for Personalized Assessment: An Example from Thyroid Function Tests." In Communications in Computer and Information Science. Springer Nature Switzerland, 2025. https://doi.org/10.1007/978-3-031-88346-0_5.

Full text
Abstract:
Abstract Using population-wide thresholds assumes normal variation in thyroid hormone levels is the same across individuals which may leave patients (with varying medical histories) undiagnosed and untreated. This analysis aims to assess whether patient-specific thresholds for thyroid hormone laboratory tests are justifiable within a heterogeneous pediatric population. The study data, obtained from Cerner Real-World Data, consists of observations from January 2016 to December 2019 of pediatric patients with at least two laboratory records for thyrotropin (TSH), free thyroxine (T4), total T4, o
APA, Harvard, Vancouver, ISO, and other styles
4

Han, Doo Chol, Kanji Sato, Yuko Fujii, Toshio Tsushima, and Kazou Shizume. "3,3′,5′-Triiodothyronine (rT3) Inhibits Iodothyronine-5′-Deiodinating Activity Induced by Equimolar Concentration of 3,5,3′-Triiodothyronine (T3) in Cultured Fetal Liver of Mouse." In Frontiers in Thyroidology. Springer US, 1986. http://dx.doi.org/10.1007/978-1-4684-5260-0_146.

Full text
APA, Harvard, Vancouver, ISO, and other styles
5

Giovanella, Luca, Federica D’Aurizio, and Petra Petranović Ovčariček. "Biochemical Diagnosis of Thyroid Dysfunctions." In Integrated Diagnostics and Theranostics of Thyroid Diseases. Springer International Publishing, 2023. http://dx.doi.org/10.1007/978-3-031-35213-3_3.

Full text
Abstract:
AbstractThyroid dysfunctions are among the most common endocrine disorders and accurate biochemical testing is integral to assess thyroid patients. Notably, true hyperthyroidism and hypothyroidism in the setting of a normal thyroid-stimulating hormone level are highly unlikely, making the assessment of free thyroxine (FT4) inappropriate in most new cases. However, FT4 measurement is pivotal in both the diagnosis and management of relevant central dysfunctions (central hypothyroidism and central hyperthyroidism) as well as for monitoring therapy in hyperthyroid patients treated with antithyroid
APA, Harvard, Vancouver, ISO, and other styles
6

Gavaret, Jean-Michel, Min Luo, and Robert Faure. "Regulation of 19,000 Mr Soluble Protein and High Mobility Group Protein (HMG 14) Phosphorylation by Triiodothyronine (T3) in Primary Astrocytic Cultures." In Frontiers in Thyroidology. Springer US, 1986. http://dx.doi.org/10.1007/978-1-4684-5260-0_115.

Full text
APA, Harvard, Vancouver, ISO, and other styles
7

Iriuchijima, Tokuji, Debbie Rogers, and John F. Wilber. "TSH Secretory Regulation: New Evidence that Triiodothyronine (T3) and Thyroxine (T4) Can Inhibit TRH Secretion Both in Vivo and in Vitro." In Frontiers in Thyroidology. Springer US, 1986. http://dx.doi.org/10.1007/978-1-4684-5260-0_37.

Full text
APA, Harvard, Vancouver, ISO, and other styles
8

Gordon, Janice T., Mary B. Dratman, and Alfred L. Yergey. "Chromatographic Properties and Probable Structure of the Urinary Conjugate of an Ethane-1,2-Diol Formed in Vivo from 3,5,3’-Triiodothyronine (T3)." In Frontiers in Thyroidology. Springer US, 1986. http://dx.doi.org/10.1007/978-1-4684-5260-0_73.

Full text
APA, Harvard, Vancouver, ISO, and other styles
9

Caquet, René. "Triiodothyronine (T3) (T3 libre)." In Guide infirmier des examens de laboratoire. Elsevier, 2008. http://dx.doi.org/10.1016/b978-2-294-70220-4.50153-3.

Full text
APA, Harvard, Vancouver, ISO, and other styles
10

Vanderpump, Mark P. J., and W. Michael G. Tunbridge. "Thyroid overactivity caused by Graves’ disease." In Thyroid disease. Oxford University PressOxford, 2008. http://dx.doi.org/10.1093/oso/9780199205714.003.0004.

Full text
Abstract:
Abstract Overactivity of the thyroid gland, also known as hyperthyroidism or thyrotoxicosis, is a disease in which increased amounts of thyroid hormones are present in the bloodstream. Usually the levels of both thyroxine (T4) and triiodothyronine (T3) are increased above normal; however, in some people with thyroid overactivity only the T3 level is raised but the symptoms and the findings are just the same in this so-called T3-toxicosis as when both T4 and T3 levels are raised.
APA, Harvard, Vancouver, ISO, and other styles

Conference papers on the topic "T3 (Triiodothyronine)"

1

Younus DHANNOON, Azhar, and Abeer Ataallah Ayyed AL-HADIDY. "ESTIMATION OF SOME ADIPOSE TISSUE HORMONES (VISFATIN AND ADIPONECTIN) IN PATIENTS WITH HYPOTHYROIDISM." In V. International Scientific Congress of Pure, Applied and Technological Sciences. Rimar Academy, 2022. http://dx.doi.org/10.47832/minarcongress5-22.

Full text
Abstract:
Hypothyroidism is a medical state referring to the lack of secretion of thyroid hormones (THs) in the body. It occurs when the thyroid gland starts to produce and secrete a small amount of thyroid hormones Thyroxine (T4) and Triiodothyronin (T3), this will affect body cells, resulting in a slowing of the body's metabolic rate, weight gain, and tachycardia. Visfatin and adiponectin are two hormones from type adipokine produced from fat tissue. Those hormones have an important function in protein, lipid and glucose metabolism, as well their role in energy expenditure. Eighty cases of both sexes
APA, Harvard, Vancouver, ISO, and other styles
We offer discounts on all premium plans for authors whose works are included in thematic literature selections. Contact us to get a unique promo code!